KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0193
Entry
BP1026B_II0193    CDS       T02049                                 

Gene name
tssC-3
Definition
(GenBank) type VI secretion system
  KO
K11900  type VI secretion system protein ImpC
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0193 (tssC-3)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0193 (tssC-3)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFI68474
UniProt: A0A0H3HQC9
Position
2:complement(229191..230690)
AA seq 499 aa
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISD
DAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDI
SKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGS
ISKVAASAHTPFISGASPSVLQMESWQELANPRDLTKIFTQNLEYASWNALRNMDDARYI
GLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWTNAAYAMGVNINRSFRLYGWC
SLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGFIPLVHRKNTD
HATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLE
GLTVSLRLVAKLPSIKEAA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaagaaacagcaagcccagacggccgccgccggcgtccagccgcaagcggattcggat
ttcgcgcagttgctcgcgcaggagttcaagccgaagacggagcaggcgcgcgaagcggtc
gaatacgcggtgcgcacgctcgccgagcaggcgctcgcgcaatcggcgacgatcagcgac
gatgcatacaagagcatcgccgcgatcatcgcgcagatcgaccataagctatccgaacag
atcaacctgatcctccatcacgcggatttccagaagctcgaatcggcgtggcgcgggctg
catcacctggtgtcgaacaccgagaccgacgagcgcctgaagatccgcttcatggacatc
tcgaaggaagagctgcgccgcacgatgcggcgctacaaggggcaatcgtgggaccagagc
ccgctcttcaagcagatctacgaggaggagtacgggcagctcggcggcgagccgtacggc
tgcctcgtcgccgattactacttcgaccacacgccgcccgacgtcgacctgctcggctcg
atctcgaaggtggccgcgtccgcgcacacgccgttcatctccggcgcgtcgccttcggtg
ctgcagatggaatcgtggcaggagctcgcgaacccgcgcgacctgacgaagatcttcacg
caaaacctcgaatacgcgtcatggaacgcgctgcgcaacatggacgacgcgcgctacatc
ggcctcgcgatgccgcgcttcctgtcgcgcctgccgtacggcgtgctgacgaatcccgtc
gacgagttcgacttcgaggaagacacgaacggcgccgaccatcgccgctacgcgtggacg
aacgccgcctacgcgatgggcgtgaacatcaaccggtcgttccggctctacggctggtgc
tcgctcattcgcggcgtcgaatcgggcggcacggtcgagaacctgccgtgccatacgttc
ccgaccgacgacggcggcatcgacatcaaatgcccaaccgagatcgcgatctcggaccgg
cgcgaggcggagctgtcgaagaacggcttcattccgctcgtgcaccgcaagaacaccgat
cacgcgacgttcatcggcgcgcaatcgctgcacaagccggccgaatacgacgattccgac
gcgacggccaacgcgaacctgtcggcgcgcctgccgtatctgttcgcatgctcgcgcttc
gcgcactacctgaagtgcatcgtgcgcgacaaggtgggcgccttcaaggagcgcgaggac
atgcagcgctggctgaacgaatggatcatgaactacgtcgacgcggacccggcgaactcg
tcgcaggacacgaaggcgcgccggccgctcgcggccgccgaggtggtcgtcgagcaggca
cagggcaaccccggctactaccaggcgaagttcttcctgcggccgcatttccagctcgag
ggcctgaccgtgtcgctgcggctcgtcgcgaagctgccgtcgatcaaggaagccgcctga

DBGET integrated database retrieval system