KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0194
Entry
BP1026B_II0194    CDS       T02049                                 

Gene name
tssB-3
Definition
(GenBank) type VI secretion system
  KO
K11901  type VI secretion system protein ImpB
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0194 (tssB-3)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0194 (tssB-3)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFI68475
UniProt: A0A0H3HUC8
Position
2:complement(230725..231306)
AA seq 193 aa
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADR
RFLDIDIDNFDERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLR
QLLEARTQLANLQTYMDGKSGAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAK
DAPDTANHDSDAA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtccgcatccagcagctctcaaaaattcatcgcgcgcaaccgcgcgccccgcgtgcag
atcgaatacgacgtcgaagtctacggctcggaaaagaaggtcgaactgccgttcgtgatg
ggcgtgctcgccgacctgtcgggcaagccggtcgcgccgctgcccgccgtcgccgaccgg
cgcttcctcgacatcgacatcgacaacttcgacgagcggatgaaggcgatcaagccgcgc
gtggcgttcgcggtggacaacacgctgtcgggcgacgggcagctgatggtcgacatgacg
ttcgaaagcatcgaggacttctcgcccgccgcgatcgcgcgaatggtcggcccgttgcgg
caattgctcgaggcgcgcacgcagctcgcgaacctgcagacctacatggacggcaagtcg
ggcgccgagacgctcgtcaaccagttgctgcaggacccggcgctgctgcgctcgctcgcg
gccgcgccgaagccgcagctcgcgggcgggccggacgcgggcaatgcgcgcggcgcgaag
gacgcgcccgacacggcgaaccacgacagcgatgcggcctga

DBGET integrated database retrieval system