KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0198Help
Entry
BP1026B_II0198    CDS       T02049                                 

Gene name
tagJ-3
Definition
(GenBank) type VI secretion system
  KO
K11898  type VI secretion system protein ImpE
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0198 (tagJ-3)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BP1026B_II0198 (tagJ-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE Nic96
Motif
Other DBs
NCBI-ProteinID: AFI68479
UniProt: A0A0H3HQD2
Position
2:235530..236495
Genome map
AA seq 321 aa AA seqDB search
MTTPAFPAPPGARTSARPHDTLLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERA
VGQLQAYARFAAQHAHIAHAYRDLIRAERFRARVMAGHARPGFVFDAPPWIDDLLEALRA
QAAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFS
DLAGWRLARPGVPLDLVWAPCVLTLADGSVAHGFMPARYPGSELADGSGAPGASAAAHEA
DAHESAVREADALRLGSRTAWRDVGRTGVFALGRKTWSTSAGDAGLFELHACEFGARARA
GAVLGGAAREARGGEAADGCA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcctgccttcccggcgccgcccggcgcgcgcacgtcggcccggccgcacgat
acgctgctcgacgcgcggctcgcggctgcgcaagccgcggtgcgcgcccggcccgtcgat
gcggcgagccgttgggcgctgtttcaactgctctgcgtgacgggccagtgggaacgcgcc
gtcgggcagttgcaggcttatgcgcggttcgccgcgcagcacgcgcacatcgcgcacgcc
tatcgcgacctgattcgcgccgagcgctttcgcgcccgcgtgatggcgggccacgcgcgg
ccgggattcgtattcgatgcgccgccgtggatcgacgatctgctggaagcgttgcgcgcg
caggcggccggcgcgcgcgacgaagccgaccgcgcgcgttcgcgcgcgctcgatcgcgcg
ccgttcgtcgcggggcgcgggccggatgcgccgttcgactggatcgccgacagcgattcg
cgattcgggccggtctgcgaagtcgtgaccgccgggcatgatcgttggctgccgttttcg
gatctggccggatggcggctcgcgcgcccgggcgtgccgctcgatctggtctgggcgccg
tgcgtgctcacgcttgccgacggcagtgtcgcgcacggcttcatgccggcgcgttacccg
ggctccgaactggccgacgggagcggcgcgccgggcgcctcggcggccgcgcacgaggcc
gatgcgcacgagagcgccgtgcgcgaggccgatgcgttgcggctcggcagccggaccgca
tggcgcgacgtcggccgcaccggcgtgttcgcgctcggccgcaagacctggtcgacgagc
gcgggcgacgccggccttttcgagctgcacgcgtgtgaattcggcgcgcgcgcccgtgcg
ggcgccgtgctcggcggcgcggcgcgcgaagcgcgcggcggggaggcggccgatggatgc
gcatga

DBGET integrated database retrieval system