KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0203
Entry
BP1026B_II0203    CDS       T02049                                 

Gene name
vgrG-3
Definition
(GenBank) type VI secretion system
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II0203 (vgrG-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0203 (vgrG-3)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0203 (vgrG-3)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V TFIIA
Other DBs
NCBI-ProteinID: AFI68484
UniProt: A0A0H3HQD7
Position
2:241240..243567
AA seq 775 aa
MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSEIYSYTLDCLTPPDPLLAHER
AANLDLKAMIGKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAREISGIVTGARFEGQLN
RQCRYRLTMRPWIYLADLRSDYRIFQNWSVDEIVDEVLNAYSYSYDKRLSGRYPKLGYQV
QYGETDFAFIQRLMQEHGIYWFFEHTNQVHRMVLVDHLGAHKPVESAAYRTLRYYPPGHK
IDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENALPRDTAHNGLERYEWPGDYTA
REHGEHFARVRMEQTRARGERASGGGNVRDIVCGTTFALAGHPHASANREYLVIGATFEA
TETGGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTRGPQTAIVTGPRGQDIWTDQYG
RVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNIPRVGSEVVVDFEHGDPDRPLVT
GQVYNALHMPPWPLPENATQSGFMTRSPAGGGENANMLRFEDKAGEEQVKLHAERNYDVS
VERDATTAVGRKHLTLVGVDLMPVMSTRSPLERLIDLLRTGGAASPAASGQPAAASRQPS
GQQQQHQQQHQQHQRQRQPYQQLKQQRQMQRAGGWQALAANVAKTLQEIVAVLTDPFVTA
SVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAHSEVNGTASSKDVNSVSLKGTSTSLTG
VSTSETGTNIVTTGLTVSTTGASVSTTGFSATETLVQVAKKTQECEFIKGIKISM
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgccgaatttttccgccgcccgcaccgtgacggtgagcggccctgccgtgccgacgacg
cccgtcggcgagcccgcgctcgaactgagcgcgatccggggcgacgaaacgctatcggag
atctattcgtacacgctcgattgcctgacgccgccggacccgttgctcgcgcacgagcgg
gccgcgaatctcgatctgaaggcgatgatcggcaaggcgctgaccgtgaccgtgcagctc
gaaggcatgggctcgttcgtgcccggcatgccgggcatggcgggcgcggccaatatcggc
gcgggcgcgcgcgagatcagcggcatcgtgaccggcgcgcgcttcgagggccaactgaac
cggcagtgccgctaccggctgacgatgcggccgtggatctacctggccgacctgcgctcg
gactaccggattttccagaactggagcgtcgacgagatcgtcgacgaagtgctgaacgcg
tattcgtactcgtacgacaagcgcttgagcggccggtatccgaagctcggctaccaggtg
cagtacggcgagaccgatttcgcgttcatccagcggctgatgcaggagcacggcatctac
tggtttttcgagcatacgaaccaggtgcaccggatggtgctcgtcgatcacctgggcgcg
cacaagccggtggagagcgccgcataccgcacgctgcgctactacccgccggggcacaag
atcgacgccgagtacatcgacaggttcagcaccgaggagcacatccggccgggccgctgg
gcgacgggcgatttcgatttcgagaagccgaacgcggacctgggcgtcgagaacgcgctg
ccgcgggacaccgcgcacaacgggctcgaacgttacgagtggccgggcgactacacggcg
cgcgagcacggcgagcacttcgcgcgcgtgcgcatggaacagacgcgcgcgcggggcgag
cgcgcatcgggcggcggcaacgtgcgcgacatcgtgtgcggcacgacattcgcgctcgcg
ggccatccgcacgcgagcgcgaaccgcgagtatctggtgatcggcgcgacgttcgaggcg
acggagacgggcggcgcgtcggggccgggcgcatatcggatcgacacgtcgttcgtcgcg
cagccggcgaccaccgcgttccggccgccgcgcacggtgcgcaagccgcgcacgcgcggg
ccgcagacggcgatcgtcaccggcccgcgagggcaggacatctggacggaccagtacggc
cgtgtgaagctgaaattccactgggaccgttcgctcgtcgacgatcagaactcgtcgtgc
tgggtgcgcgtttcctatgcgtggtcgggcaacaattacggcggcgtcaatattccgcgc
gtgggctccgaagtggtcgtcgatttcgagcacggcgacccggaccggccgctcgtgacg
gggcaggtatacaacgcgctgcacatgccgccgtggccgttgccggagaacgcgacgcaa
agcggcttcatgacgcgctcgcccgcgggcggcggcgagaacgcgaacatgctgcgcttc
gaggacaaggcgggcgaggagcaggtcaagctgcatgcggagcgcaattacgacgtatcg
gtcgagcgcgacgcgacgactgccgtcgggcgcaagcacctgacgctcgtcggcgtcgac
ctgatgccggtgatgtcgacgcgctcgccgctggagcggctgatcgacctgctgcgcacg
ggcggcgcggccagcccggcggcgtcggggcagccggcggcggcttctcggcaaccgtcg
ggacagcagcagcaacatcaacagcaacaccagcaacatcagcggcaacgccagccctat
cagcagttgaagcagcagcgccagatgcagcgcgcgggcggatggcaggcgctcgcggcg
aacgtcgcgaagacgttgcaggaaatcgtggcggtgctcacggacccgttcgtcaccgcg
tcggtgagcaccgtgcagggcgcgtcgacgtccgtcgtgttcggcgacgcgaagggcgtg
cacgtgggcgataccgtcaagatcaccagcggagacgcgcattcggaggtcaacggcacg
gcatcgtcgaaggacgtgaacagtgtctcgctgaagggcacgtcgaccagcctgaccggg
gtcagcacctccgaaacggggacgaacatcgtgacgaccggactcacggtatcaacgacc
ggcgcgagcgtttcgacgaccggattcagtgcgaccgaaacgctcgtgcaggtcgccaag
aagacgcaggaatgcgaattcatcaagggcatcaagatctcgatgtga

DBGET integrated database retrieval system