KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0576
Entry
BP1026B_II0576    CDS       T02049                                 

Gene name
tssE-4
Definition
(GenBank) type VI secretion system
  KO
K11897  type VI secretion system protein ImpF
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0576 (tssE-4)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0576 (tssE-4)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFI68839
UniProt: A0A0H3HRH0
Position
2:710679..711110
AA seq 143 aa
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPM
QMAGATKINPVHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKARED
GAELRASLALDYLSGYFSLADDR
NT seq 432 nt   +upstreamnt  +downstreamnt
gtgagcgatcttcaactctacaacaagctgtcgaaacggattcgtcgccattcgctgcaa
gaggtcgtggccgaccacttggtcgatctgatgaatcacgcgatccgcggtgcgcgcatg
cgcatcgcggacgacagcccggccgcgcattcggtgctgaacttcggttgtccgccgatg
cagatggccggtgcgacgaagatcaatccggttcatgcggccgcgcatatctgcgaggtg
attcgccgcttcgagccgcgcgtggaccctgccagcacggtggtcaagccgcgcacggag
agccgcaagcgcctcgcgcagacgatttatttcgacgtgtcgatgaaggcgcgcgaagac
ggagccgaactcagggcgagcctcgcgctcgactatctgagtggttatttcagcctggcg
gacgaccgatga

DBGET integrated database retrieval system