KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0588
Entry
BP1026B_II0588    CDS       T02049                                 

Gene name
tssL-4
Definition
(GenBank) type VI secretion system
  KO
K11892  type VI secretion system protein ImpK
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II0588 (tssL-4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0588 (tssL-4)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0588 (tssL-4)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AFI68851
UniProt: A0A0H3HSD6
Position
2:728002..729717
AA seq 571 aa
MSLLRNLSSTLRRVSMASNMLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVA
SGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGGAPAPADARVAAPVVYSAQGEQ
AAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVRLYRERLAAS
GCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSR
WMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTE
LVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIA
ETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPW
PGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEY
SGRGDAQPIDTAKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMP
EGVEIAPDGQLPYATSTTMPATRPTTEGRQP
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgagcctgctacgaaacctctcctccacgctgcgccgcgtatcgatggcatccaacatg
ctcgatcgcgcggcggcgaatccggatctcgtgacgcgcgtgccgacgctgtcgtcgctg
tcgagcgcggcgatgacgagctccgccgtatcgaccaccggcacgacgaacacggtggcg
tcgggcggcgcggccgcgggcgcgccgagcttcgcgccgccggccgccgacgcgtttccc
caagccgacggcgcgccccgcaaccccgcggtgctgcaattcccggtgccgggcggcgcg
cccgcgcccgccgacgcgcgggtggcagcgcccgtcgtctacagcgcgcagggcgagcag
gccgcgatcatgaaagcaggcctgcagcaggcgagctggaacaacccgttcgtgtcgcac
gcgctgcccgcggtgctgcaactgcagcgccacctcgcggccggcccgctcaatcaggcc
gcgatccgcacgcagctcggcctcgaggtgcggctctaccgcgagcggctcgccgcctcc
ggctgcgaatgggagcagatccgcgacgcgtcgtacctgctctgcacgtatctcgacgaa
accgtcaacgacgcggcgcgcgagcacgcgcaagtcgtctacgacggcgagcgcagcctg
ctcgtcgaattccacgacgacgcgtggggcggcgaggacgcgttcgccgacctgtcgcgc
tggatgaagaccgagccgccgccgattccgcttctgtcgttctacgaactgatcctgtcg
ctcggctggcagggccgctaccgcgtgctcgaccgcggcgacgtgctgctgcaggatctg
cgctcgcaactgcacgcgctgatctggcatcacgtgccgcccgagccgctcggcaccgag
ctcgtcgcgcccgcgaagcggcgccgctcgtggtggacggccgggcgcgcggcggccgtc
gcgctcggcgtgctggtgctcgcgtacggcgcgatcagcttctggctcgattcgcagggc
cgcccgatccgcaacgcgctcgccgcgtggatgccgcccacgcgcacgatcaacatcgcc
gagacgctgccgccgccgctgccgcagattctcaccgaagggtggctcaccgcgtacaag
catccgcaaggatggctgctcgtgttcaagagcgacggcgcgttcgacgtcggcaaggcg
aacgtgcgggcggacttcatgcacaacatcgagcggctcggcctcgcgttcgcgccgtgg
ccgggcgacctcgaggtgatcggccacaccgattcgcggccgatccgcacgagcgagttc
ccggacaaccaggcgctgtccgaagcgcgggcgcgcaacgtcgccgacgaactgcgcaag
accgcgctgccgggcggcgcgcgcgcgccggagaacgcggtgcagcgcaacatcgagtac
tcggggcgcggcgacgcgcagccgatcgacaccgcgaagacggccgccgcgtacgagcgc
aaccgccgcgtcgacgtgctgtggaaggtgattcccgacggcgcgcagcaatcgggccgc
agcctgaacctgcagcagccggagaagcccgggcaggtgccgatgcgtccggcgatgccg
gagggcgtggagatcgcgcctgacgggcaactgccgtatgcgacgtcaaccacgatgcca
gcaacgcgaccgaccacggagggccgtcagccatga

DBGET integrated database retrieval system