KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1077Help
Entry
BP1026B_II1077    CDS       T02049                                 

Definition
(GenBank) histidine ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BP1026B_II1077
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpz02000]
    BP1026B_II1077
Transporters [BR:bpz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BP1026B_II1077
   Histidine transporter
    BP1026B_II1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFI69328
UniProt: A0A0H3HYY1
Position
2:1306297..1306986
Genome map
AA seq 229 aa AA seqDB search
MLFQGFGPLLWAGTIETVKLAVLSLAASLVLGLAGAAAKLSSNRALASVGTFYTTLIRAV
PDLVLMLLLFYGIQILLNDVTDMLGAEQIDIDPFVAGIVTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMGAWRVFARIMFAQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTLNFFFFTLAAGAIYLAITTLSNLVLMYLEKRYSAGVRRVAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctctttcaaggcttcggcccgctgctctgggccggcacgatcgagacggtcaagctc
gccgtgctttcgctcgccgcgtcgctcgtgctcgggcttgccggcgcggccgccaagctg
tcgtccaatcgcgcgttggcgagcgtcggcacgttctacacgacgctgattcgcgcggtg
ccggatctcgtgctgatgctgctgctgttctacggcatccagatcctgctgaacgacgtg
accgacatgctcggcgccgagcagatcgacatcgatccgttcgtcgccggcatcgtcacg
ctgggcttcatctacggcgcctatttcaccgagacgtttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaagcgggcttcgcgtacggcatgggtgcgtggcgtgtgttcgcg
cggatcatgtttgcgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcgggctggccgacgtcgtgaaggcc
gcgcaggacgccggcaagagcacgctgaatttcttcttcttcacgctcgcggcgggcgcg
atctacctcgcgatcacgacgctgtcgaacctcgtgttgatgtacctcgaaaaacgctat
tcggcgggtgtgcggagggtggcgctgtga

DBGET integrated database retrieval system