KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1078Help
Entry
BP1026B_II1078    CDS       T02049                                 

Definition
(GenBank) histidine transport ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BP1026B_II1078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpz02000]
    BP1026B_II1078
Enzymes [BR:bpz01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BP1026B_II1078
Transporters [BR:bpz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BP1026B_II1078
   Histidine transporter
    BP1026B_II1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_13 AAA_15 AAA_23 AAA_16 AAA_33 PRK NACHT G-alpha RsgA_GTPase CobU AAA_22
Motif
Other DBs
NCBI-ProteinID: AFI69330
UniProt: A0A0H3HWY2
Position
2:1307765..1308532
Genome map
AA seq 255 aa AA seqDB search
MDKLTVDDLHKKFGDNEVLKGISLRAKAGDVISIIGSSGSGKSTFLRCINFLEQPCSGAI
TLGGETIRVTRDRRGAPRIGDPKQLQRMRVKLAMVFQHFNLWAHMTVLENVTEAPVSVLG
LSRAEADARAREYLRKVGLAPGVEAKYPSHLSGGQQQRVAIARALAMEPEVMLFDEPTSA
LDPELVGEVLKVMQALAEEGRTMIVVTHEMGFARNVSNHVIFLHQGRIEEEGHPQDVLVH
PKSERLSQFLSGRLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgacagtggacgacctgcacaagaaattcggcgacaacgaggtgctcaag
ggcatctcgctgcgggcgaaggcgggggacgtgatcagcatcatcggctcgagcggctcc
ggaaagagcacgttcctgcgctgcatcaactttctcgagcaaccgtgctcgggcgcgatc
acgctcggcggcgagacgatccgcgtgacgcgcgaccggcgcggcgcgccgcggatcggc
gacccgaagcaattgcagcggatgcgcgtgaagcttgcgatggtgttccagcacttcaac
ctgtgggcgcacatgacggtgctcgagaacgtgaccgaggcgcccgtcagcgtgctcggc
ctgtcgcgcgccgaagccgacgcgcgggcgcgcgagtatctgcggaaggtggggctcgcg
ccgggcgtcgaggcgaagtatccgtcgcacctgtcgggcggccagcagcagcgcgtcgcg
atcgcgcgggcgctggcgatggagcccgaagtgatgttgttcgacgagccgacgtctgcg
ctcgatccggagctcgtcggcgaagtgctgaaagtgatgcaggcgctggcggaagaaggg
cgcacgatgatcgtcgtcacgcacgagatgggcttcgcgcgcaacgtatcgaatcacgtg
atcttcctgcaccaggggcggatcgaagaggaggggcatccgcaggacgtgctcgtccat
ccgaagagcgagcggctgtcgcaattcctgtcgggccggctcaaatag

DBGET integrated database retrieval system