KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1283
Entry
BP1026B_II1283    CDS       T02049                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II1283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II1283
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II1283
SSDB
Motif
Pfam: Phage_GPD T6SS_Vgr DUF2345 Phage_base_V DUF3540
Other DBs
NCBI-ProteinID: AFI69530
UniProt: A0A0H3HZL2
Position
2:complement(1607203..1609989)
AA seq 928 aa
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCV
STRRDLPPGVLLGIPVSIRLITDRGQPHTVSAIISGVQIGQSDGELCVYQLTVCDALSLM
DKRTNSRVFRKRSVIEVLATLFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNES
DAHFVRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCDDPMSLPQAPAGTVRLHPR
DGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSVASSLDQGEAGNDLAKLLTD
IAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITLTGDPQWDRQR
ADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAYAPRALPSALANDADTRYENTF
ACVRRGVPLVPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHA
QGAGTNGNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGA
HPPATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGY
LTQPRENGHGNDRGEGVELRTDAAAALRAAQGMLLTTYARTQASGGQLDRDELIRLLGEC
AELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTGTDGAAAPSDGAARALMAFGAQ
AGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGP
MLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKL
LSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEG
KTDASGLTDLVKDDAMRIAKIDYLKPKL
NT seq 2787 nt   +upstreamnt  +downstreamnt
gtgaccaatttgaacgatacgctacgcaattttgcgtcgggggcggtcgactggaataaa
cgtccggtcgcgttgcactttggcgccgcgcaggccgcgctgggccacctcctcgcgctg
cagcacgccagtgttcaggaagggctgatgaccgggatccacggccgattgacctgcgtg
tcgacccgccgcgaccttccgcccggcgtgttgctcggcattccggtttcgatccggctg
attaccgaccgcggacagccgcacacggtgagcgcgatcatcagcggcgtccagatcggc
caaagcgacggcgagctctgtgtgtaccagctgacggtctgcgacgcgctgtcgctgatg
gacaagcgcaccaattcgcgggtcttccgaaagcgcagcgtcatcgaggtgctcgccacg
ctgttcaacgaatggcagcagcgcagcccggccctcgcgcgcgcgttcgaattcgatctg
tccggcttgcgcgccgatcgctatccgccccgcgagctgacccggcaggtcaacgaatcg
gatgcgcatttcgtgcgccgtctgctgcgccgcgaagggatcaccgtgttcgcgaaggcg
gggccggcgaagggcgaacggccgttgcagggcgacgcgcccgtgcacacgctcgtgtgc
tgtgacgatccgatgtcgttgccgcaagcgccggccggcacggtccgcttgcatccgcgc
gacggcggcgccgcgcagcgcgacacggtcacgctgttcgcgctgcgtcggcaattggcg
cccggcaaggccgggcgcccgtcgtgggactacaagaaggcgcggatcgacgaatcgagc
gtcgcttcgagcctcgatcagggcgaggcgggcaacgatctggcgaagctgctgaccgac
atcgcgatcgacattgcgcacgcgggcgattcatggcgcgatcacgagcggctcacccgc
gcgcgcatgctcgcgcacgagttcgaagccgagcgccatgacggcgtcagcagcgtgcgg
gatctcgccgtgggcacatggatcacgctgacgggcgatccgcaatgggacaggcaacgc
gccgacaagcgtcagttcgtgatcacgtcgatcgatcatgacatctggaacaacctgccg
aaggggctcaacgagcgcgtgcacgcgctgttcgccgcgagccgcaatctcgcgtacgcg
ccccgcgcgctgccgtccgcgctggcgaacgacgcggatacccgctacgagaacacgttc
gcgtgcgtgcgccgcggcgtgccgcttgtgcccgcgtacgatccgcaagccgatttgccg
cccgcgcatctgctcacgggcacgattgtcggcgcggagggcgaagaagtgttctgcgac
gaagacggccgggtgcgcgtgcgggtgcacggcctcgatccggcggatcacgcgcacgcg
cagggcgcgggcaccaacggcaacgcgggcgacagcgcgccgatccgcgtggcgtcgagc
ctcgccggcgcccatttcggcgcatcgtttctgccgcgagtcggcatggaagtccttctc
gggtgtctcggcggcgatccggaccggctggtgatcatcggcgtgctcggtaacggcgcg
catccgccggcgacgttcagccacgcgggcgggctgccgggcaaccgctacctgtcgggc
atcaagacgaaggagattcgtgggcaacggtacaaccagctgcgtctcgacgacacgccg
aaccagatcagcgcgcaactggcgagcgagcacgcgcattcgcagctcaatctcggatat
ctgacgcaaccgcgcgagaacggccacgggaacgaccgcggcgagggcgtggagttgcgt
accgacgcggcggcggcgctgcgggcggcgcaaggcatgctgctgacgacctacgcgcgc
acgcaggcgagcggcgggcaactggaccgtgacgagctgattcggttgctcggcgaatgc
gcggagctgttcaaggcgctgggcgactacgcggggcagcacggcgggcaggccgcggat
acggccggccagcacgcggtggccgccgcgttcaagcgctgggcgccgggcacgggcacg
gacggcgccgctgcgccgtccgacggcgcagcgcgcgcgctgatggcgttcggcgcgcag
gccggttcggtgaacgtcacgccgaagacgcatgtgacgtatgccggcgagaacatcgat
caggtcgcgcagcagcacctgcaactgatgagcggccagcggctgaacgcgacggccggg
cagggcatgcagctcttcgcgcggggcgcgggggtgcaggccgtggcgggcgaagggccg
atgctgctgcaggcgcaagccggcacgctgacggcgaacgcgcagaagggcgtcaagatc
acgacgaacgagcacgaggtgttcgtgagcgcgccgaagattcggctcgttgccgaggac
ggcagctacctcgagctcggcggcggcatcacgctcggcacgaacggcgacatcaagctg
ctgtcggcgtcgcaccagtggggcgggccgtcgaccgcgcaggcggcgaagagcgggttc
ggcaatcagccgacggatcagcgtttcaagctgcactatccgggcgaggacggcgatttg
caggcggcggcgaacaagcggttccggatcacgctggacgacgggcgcgtcatcgaaggc
aagaccgacgcgagcggcctgacggatctggtcaaggacgacgcgatgcgtatcgcgaag
atcgactatctgaaaccgaagctctga

DBGET integrated database retrieval system