KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1591
Entry
BP1026B_II1591    CDS       T02049                                 

Gene name
hcp-5
Definition
(GenBank) type VI secretion system
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II1591 (hcp-5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II1591 (hcp-5)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II1591 (hcp-5)
SSDB
Motif
Pfam: T6SS_HCP THP2
Other DBs
NCBI-ProteinID: AFI69829
UniProt: A0A0H3HVA0
Structure
PDB: 
3WX6

Position
2:2012534..2013043
AA seq 169 aa
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTIT
LTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQ
YSPTPHKDDSNGIKEGLLGYIEEIKFTYSGYSLEHAESGIAGAANWTNG
NT seq 510 nt   +upstreamnt  +downstreamnt
atgctggccggaatatatctcaaggtcaaaggaaaaacccagggggaaatcaaaggctcc
gtcgttcaggaaggtcatgacgggaaaatccacatcctcgccttcaagaacgactacgac
atgcctgccaggctccaggaaggcctgacgcccgccgccgccgctcgcggcacgatcacg
ttgacgaaggaaatggacagatcgtcgccgcaattcctgcaggcgctcggcaagcgcgag
atgatggaagagttcgagatcacgatccaccgtccgaagacggatacaacaggtggggac
ctgaccgaactcctgttcacgtacaagttcgaaaaagtgctgatcacccacatggaccaa
tactcgcccacgccgcacaaagacgatagcaacggcatcaaggaaggcttgctcggctat
atcgaggagatcaagttcacgtattcgggatactcgttggaacacgcggaatcgggcatc
gcgggcgccgcaaactggacgaatggctga

DBGET integrated database retrieval system