KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1592
Entry
BP1026B_II1592    CDS       T02049                                 

Gene name
tssE-5
Definition
(GenBank) type VI secretion system
  KO
K11905  type VI secretion system protein
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II1592 (tssE-5)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II1592 (tssE-5)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFI69830
UniProt: A0A0H3I0H0
Position
2:2013036..2013497
AA seq 153 aa
MADRESSRAGEPRTRERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHV
PIDPAFGVPDFTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRF
SLDARLVIDAHDVPARFLTTVTGNGKIDIRTIS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctgatcgcgaatcgtcgcgggccggcgagccgcgcacgcgcgagcgccggctgctc
gagcggatcgcgaaccgggaagcgggcggcgagcacgatcgcccgccgcccgccgacgtg
ctcgcgcactcgatcatcgaccacctgcgccgcatcctgaacacgcggcagggccacgtg
ccgatcgatcccgccttcggcgtgccggatttcacgaatctcgcgggcggcttcgcgcaa
ggctccgcccgcgaaatcgaagcgcagatcgagcgcgtgatcacctgctacgagccgcgg
ctgaaagcgccgcgcgtctcgctcgccgagcgcgggcccgatgcggcgacgctgcgcttc
agcctcgatgcgcggctcgtgatcgacgcgcacgacgtgccggcgcgctttctgacgacc
gtcaccggcaacggaaagatcgatatccgaacgatttcctga

DBGET integrated database retrieval system