KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1602
Entry
BP1026B_II1602    CDS       T02049                                 

Gene name
tssJ-5
Definition
(GenBank) type VI secretion system
Organism
bpz  Burkholderia pseudomallei 1026b
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AFI69839
UniProt: A0A0H3HVA7
Position
2:2027525..2028133
AA seq 202 aa
MRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAG
GPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKR
GWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPSADA
NEGGSGKRDKRGNAAARAPRKQ
NT seq 609 nt   +upstreamnt  +downstreamnt
gtgcgatgggactacgcgcccgacgcgctgcgcatcgatatcgacgcgtcggcgcggttg
aacgaatacctgaacgcgccgcacacgctgttgctcgcggtgttccagagcgcggacgcg
aaggcgttccgccagctcgccgacgatccggaccggctgcgcatgacgctcgcggcgggc
ggccccgccgcggacttcattcagacgacccgctacgtcgtcgcgcccggccagcatgtc
gcgctgtcgatcgatcgcgcgcagcaggcgcgctacgtcggcatcgtcgccggctactac
gacgccgacggcccacgcgcggcgcgcctgttcgaggtgccgctgcgcatcgacaagcgc
ggctggttctcctccacctatcgcgccgcgccgcgaacgctcgagctgaagctcaggctc
ggcgcgcagagcatcaccgacgcgcgcgaagcgccgctgaacctgccgccgccgggcgcg
cgcgcatggacggcgctcgacagcggcgcgaagaccctggcgctgccgagcgccgacgcg
aacgagggcggcagcggcaagcgcgacaaacgcggcaacgccgccgcccgtgcgccgcgc
aagcaatga

DBGET integrated database retrieval system