KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1938Help
Entry
BP1026B_II1938    CDS       T02049                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00360  Phenylalanine metabolism
bpz00362  Benzoate degradation
bpz00620  Pyruvate metabolism
bpz00621  Dioxin degradation
bpz00622  Xylene degradation
bpz00650  Butanoate metabolism
bpz01100  Metabolic pathways
bpz01120  Microbial metabolism in diverse environments
bpz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BP1026B_II1938 (mhpF)
   00650 Butanoate metabolism
    BP1026B_II1938 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BP1026B_II1938 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP1026B_II1938 (mhpF)
   00622 Xylene degradation
    BP1026B_II1938 (mhpF)
   00621 Dioxin degradation
    BP1026B_II1938 (mhpF)
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BP1026B_II1938 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Glu_dehyd_C Shikimate_DH DapB_N
Motif
Other DBs
NCBI-ProteinID: AFI70170
UniProt: A0A0H3HW61
Position
2:complement(2437288..2438181)
Genome map
AA seq 297 aa AA seqDB search
MKSKSSRTRVAILGSGSIGLDLMFKVKASEQFDLKFVVGRNANSDGLRLARSCNVETSSD
GLDFLKAHEDAYDLVFDATSAAAHKVNNRFFSDAGKFVIDLTPAKVGRLCVPCINLDDMG
AEQNVNLITCGGQASLPLAYALKQAVDEIDYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAKFSDAKKTKAILNINPAEPGVRMQTTLYAYARYRDFDRVRASVADMVEKVREYVPGY
RLVVEPLESQGRITIGLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaagtcatcgcgcacgcgggtggcgatcctgggctcgggcagcatcgggctc
gatctgatgttcaaagtcaaggcatccgagcaattcgatctgaagttcgtcgtcggacgc
aatgcgaacagcgacgggctgcggctcgcgcgcagttgcaacgtggagacatcgagcgac
ggtctcgattttctgaaggcgcacgaggatgcgtacgacctcgtgttcgacgcgacatcg
gccgccgcgcacaaggtcaacaaccgcttcttctccgacgcgggcaagttcgtgattgat
ctgacgcccgcgaaggtcggccgcctgtgcgtgccgtgcatcaatctggacgacatgggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtac
gcgctgaagcaggcggtcgacgagatcgattacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgaaattcagcgatgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggtgtgcggatgcagacgacgctctatgcgtacgcgcgctatcgcgatttcgac
cgcgtgcgcgcaagcgttgccgacatggtcgagaaggtgcgcgaatacgtgcccggctat
cggctcgtcgtcgagccgctcgaaagccaggggaggatcacgatcggtctcaccgtgcgc
gggcgcggcgactatctgcccgagtacgcgggcaatctggacatcatcaactgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system