KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2254
Entry
BP1026B_II2254    CDS       T02049                                 

Gene name
vgrG-6
Definition
(GenBank) type VI secretion system
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II2254 (vgrG-6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II2254 (vgrG-6)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II2254 (vgrG-6)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-ProteinID: AFI70464
UniProt: A0A0H3HZW6
Position
2:complement(2795826..2798030)
AA seq 734 aa
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQ
DESERHLNGIVARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVL
GTYGFPIENHLTDTYAPRDYCVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAM
ASHVALPGYEHIPFIARDRTAIADEEHIDSWLPAQEVSIGKHETSDYDYTKPRADLSAQK
IDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHERALARTDVRGIAPGYLFT
LEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLPYRSPRATPRP
RTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHS
NAFRFEDKKGAEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQ
NETVNIGKHRVAQIGGNETHGVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTE
TIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEIGSRTSTIEKAHELNVGGSQSVNVGASH
TMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTVESSASGSHSVRGKTVTSSAT
GEHTVEGTILKLNP
NT seq 2205 nt   +upstreamnt  +downstreamnt
gtgacccgcgtgttcacactcgacagcctgcacggcgacgacctgaagttccaccggctc
tacggcgaggaagcgctcgggcggatgttcgacttccggatcgaagcgctcgccgacaat
cacagcctgtcgctgaaggaactgctcggcaagccggtgacggtgcgcatccggcagcag
gacgaatcggagcgccatctgaacgggatcgtcgcgcgcgccgcgctggtcgggcggcgc
gcggagcggcattacggctatcaactgatcgtgcggccgtggctgtggctcgcgacgcgc
cgctccgattgccggatcttccagaacaagacggtgccggagatcgtgcaggacgtgctc
ggcacgtacggctttccgatcgaaaaccatctgaccgacacgtacgcgccgcgcgactac
tgcgtgcagtacaacgagaccgacgcggcgttcgtgtcgcggctgatggagttcgaaggg
atctactactacttcaagcacgccgcgcaaacgcacacgctgatgctgtgcgacgcgatg
gcgtcgcacgtcgcgctgccgggctacgagcacattccgttcatcgcgcgcgaccgcacc
gcgatcgccgacgaagagcacatcgacagctggctgcccgcgcaggaagtgagcatcggc
aagcacgagacgagcgactacgactacacgaagccgcgcgcggatctgtccgcgcagaag
atcgatccgcgcggccacgaccatgacggcttcgcgtcgttcgaatggcccggcggctat
cgcgacgatgaaccgggcgcgcattacagccgcgtgcggctcgaagagcagcaggcggag
cacgaacgcgcgctcgcgcgcaccgacgtgcgcggcatcgcacccggctatctgttcacg
ctcgaacactgcccgcgcgccgaccagaaccgcgaatacctgatcgtgcgctgccagtat
cggtttcaggagaacgcgtacgcgaccgatagcggcaacgaggcggtcgtgcacgaatct
cagacactcgtgcagccttcgagcctgccgtatcgctcgccgcgcgcgacgccgcggccg
cgcacgaacggcccgcagacggcgaccgtcgtcggcccgaagggcgaggaaatctggacg
gaccagtacgggcgcgtgaagctgcaatttcgctgggaccgctacgggcagagcgaccag
aactcgtcgtgctgggtgcgcgtgtcgagcccgtgggcgggcggcggcttcggcggcgtg
cagatcccgcgcatcggcgatgaggtggtggtcgatttcctgaacggcgaccccgatcag
ccgatcgtgacggggcgcgtgtacaacggcgagaagatgccgccatgggggctgcccggc
agcgcgacacaaagcgggctgctgtcgcgctcgtcgccgggcggcacggccgagcattcg
aacgcgtttcgcttcgaggacaagaagggcgcggagcagctgtggatgcatgcggagcgc
aacttcgacgcggagactgagcaggaccacacgctgtcggtgggccacgatcattcgcat
tcggtcggcaacaacgagatgatgagcgtcgcgaacgaccggcaaaggagcgtcgggcag
aacgagacggtgaacatcgggaaacatcgcgtcgcgcagatcggcgggaacgagacgcat
ggcgtcgcgggaaaccgcacgcggcaggtcggacagaacgaagccgtgacgatcggcgcg
aatcgcgaggcgacgatcggcggcaatcacgtggagacggtcgcgaaagacaagaccgaa
acgattgggcagggcaagacgctgaatgtcactcagcactatcagacgacttcgaagagc
atgaagaccgctgtcgccgaacatcacgccgaggagatcggctcgcgaacgtcgacgatc
gagaaagcgcacgagctcaacgttggcggttctcaatcggtgaacgttggcgcgagccac
acgatgagcgtgaagaacaacgtacatgtcggcgcgggcgatcagatctcgctcgtttgc
ggcgatgcgagcatcacgctgaagaaggacggcacgatagcgatcaacggcgtcacggtg
gaatcgagcgccagcggaagccatagcgtgcgcggcaagacagtgacgtcgtcggcgacg
ggcgagcacacggtggaaggcacgatactgaaactgaacccctga

DBGET integrated database retrieval system