KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2255
Entry
BP1026B_II2255    CDS       T02049                                 

Gene name
clpV-6
Definition
(GenBank) type VI secretion system
  KO
K11907  type VI secretion system protein VasG
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II2255 (clpV-6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II2255 (clpV-6)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II2255 (clpV-6)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 AAA_22 Sigma54_activat AAA_7 TniB IstB_IS21 AAA_25 AAA_24 Zeta_toxin AAA_18 Clp_N NACHT AAA_14 AAA_33 Hpr_kinase_C Rad17
Other DBs
NCBI-ProteinID: AFI70465
UniProt: A0A0H3HX63
Position
2:complement(2798027..2800693)
AA seq 888 aa
MSDIGRVTLFGKLNTFLYETLEQATGFCRLRGNPYVELAHWLNQMLRRPDSDVHRILRRF
DIDAAAIDRGIVSALDRLPRGAGSVSDLSAHIDDAVERAWVYATLKYDAAQIRGAVLLLA
LVKTPQLRNVLYAIARDFERIVPDVLADELERIVAGSPEAPSPAARAAAGAIGDAGAAPS
AAREGSALARYAIDLTARARAGEIDPVVGRDGEIRQIVDILLRRRQNNPLLVGEAGVGKT
AVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKGEFESRLRGVIDEASSSERPV
ILFIDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYIEKDPALTRRF
QLVQVREPEEGAALAMLRGLAAKLEAHHRVLVLDDALQAAVTLSHRYIPARQLPDKAISL
LDTACARVAVSQHAVPAPIEDVRRRIDSLRVERELIARECALGAGDAQRLDAIDASIAGE
QTTLDALDARWQAERDALGKIVDWRASLLADDSSRVLDEAARADVQAKLSAALRALAELQ
GETPLVLPAVDTHAVAAVVSDWTGIPLGRMVRDEMQSVLKLAETLAERVVGQPHAVGLIA
ERIQTARARLDDPAKPHGVFLLCGPSGVGKTETALALAETLYGGEHNAITINMSEFQEAH
TVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKAHRDVHEIFFQVFDKGWMED
GEGRYIDFRNTVILLTSNVGSERVMQLCRDPQRLPDAQTLTDALRAPLREVFPAALLGRL
TVVPYYPLTDEMLARIVALQLARIERRIEAHHGIALRCADSATALIAERCRTIESGGRMV
DAILTHTVLPRISQEILRATIEGRALRAIDVSAEDGQFVYRFEEEGAT
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgtccgatatcggccgagtgaccttgtttggaaaactgaacacttttctctacgagacc
ctggagcaggcgaccggcttttgccggctgcgcggcaatccctatgtcgagctcgcgcac
tggctgaaccagatgctccggcgcccggacagcgacgtgcaccggatcctgcgccgcttc
gacatcgacgcggcggcgatcgaccgcgggatcgtttcggcgctcgaccggctgccgcgc
ggcgcgggttccgtgtccgatctgtccgcgcacatcgatgatgcggtcgaacgcgcatgg
gtgtacgcgacgctcaagtacgacgcggcgcagattcgcggcgcggtgctgctgctcgcg
ctcgtgaagacgccgcagctgcgcaacgtgctgtacgcgatcgcgcgggacttcgagcgc
atcgtgcctgacgtgcttgccgacgagctcgaacggatcgtcgcaggctcgccggaggcg
ccgtcgcccgccgcgcgcgcggcggcgggggcgatcggcgacgcgggggcggcgccgtcc
gccgcgcgcgaaggctcggcgctcgcgcgctacgcgatcgatctgaccgcgcgtgcgcgc
gcgggcgagatcgatccggtggtcggccgcgacggcgagattcggcagatcgtcgacatc
ctgctgcgccgccggcagaacaatccgctgctcgtcggcgaggcgggcgtcggcaagacc
gcggtcgccgaaggcttcgcgctgcgcatcgtcgcgggcgacgtgccgccgccgctgcgc
gacgtcgaactgtatctgctcgacatcggcctgctgcaggcgggcgcgagcgtgaagggc
gaattcgagagccgcctgcgcggcgtgatcgacgaggcgagttcgagcgagcggcccgtc
attctgttcatcgacgaggtacacacgctcgtcggcgcgggcggcgcggcgggcacgggc
gacgcggcgaacctgttgaagcccgcgctcgcgcgcggcctgctgcgcacgatcggcgcg
acgacgtggtccgaatacaagcaatacatcgagaaggacccggcgctcacgcggcgcttc
cagctcgtgcaggtgcgcgagccggaggagggcgcggcgctggcgatgctgcgcgggctc
gccgcgaagctggaggcgcaccatcgcgtgctcgtgctcgacgatgcgctgcaggcggcc
gtcacgctgtcgcatcgctacattcccgcgcggcagttgccggacaaggcgatcagcctg
ctcgacaccgcgtgcgcgcgcgtcgcggtcagccaacacgcggtgcccgcgccgatcgag
gacgtgcggcggcggatcgatagcctgcgcgtcgagcgcgagctgatcgcgcgcgagtgc
gcgctcggcgcgggcgatgcgcaacggctcgatgcaatcgatgcatcgatcgccggcgaa
cagaccacgctcgatgcgctcgacgcgcgctggcaggcggagcgcgacgcgctcggcaag
atcgtcgactggcgggcctcgctgctggccgacgattcttcgcgcgtgctcgatgaggcg
gcgcgcgcggacgtgcaggcgaagctctcggccgcgctgcgcgcgctcgccgaattgcag
ggcgagacgccgctcgtgctgcccgcggtcgatacgcacgcggtggccgccgtggtgtcc
gactggaccggcatcccgctcgggcggatggtgcgcgacgagatgcaatcggtgctgaag
ctcgccgagacgctcgccgagcgcgtggtcggccagccgcacgcggtcgggctgatcgcc
gagcgcattcagaccgcgcgcgcgcggctcgacgatccggccaagccgcacggcgtgttc
ctgctgtgcgggccgtccggcgtcggcaagaccgagacggcgctcgcgctcgccgagacg
ctgtacggcggcgagcacaacgcgatcacgatcaacatgagcgagtttcaggaggcgcac
accgtatcgacgctcaagggcgcgccgcccggctacgtcggctacggacagggcggggtg
ctgaccgaggcggtgcggcggcggccgtacagtgtcgtgctgctcgacgaaatcgagaag
gcgcaccgcgacgtgcacgagatcttctttcaggtgttcgacaagggctggatggaagac
ggcgaggggcgctatatcgactttcgcaacacggtgatcctcctcacgtcgaacgtcggt
tccgagcgcgtgatgcagctgtgccgcgatccgcagcgcctgcccgatgcgcagaccttg
accgatgcgctgcgcgcgccgctgcgcgaggtgtttcccgccgcgttgttgggacgcctg
acggtcgttccgtactacccgctcaccgacgagatgctcgcgcggatcgtcgcattgcag
ctcgcgcgcatcgagcggcgcatcgaagcgcaccacggcatcgcgttgcgctgcgcggat
tcggcgaccgcgctgatcgccgagcgctgccggacgatcgaatccggcggccgcatggtc
gacgcgattctcacgcacacggtgctgccgcgcatcagccaggagatcctgcgcgcgacg
atcgaggggcgcgcgctgcgggcgatcgacgtgagcgccgaagacggccagttcgtttac
cgattcgaagaggagggcgcgacgtga

DBGET integrated database retrieval system