KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2259
Entry
BP1026B_II2259    CDS       T02049                                 

Gene name
hcp-6
Definition
(GenBank) type VI secretion system
  KO
K06887  uncharacterized protein
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BP1026B_II2259 (hcp-6)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFI70469
UniProt: A0A0H3HZX1
Position
2:complement(2804591..2805082)
AA seq 163 aa
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAA
YMDKGATAIIKNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAA
DRLMMQYGFQAAKVKKQYWQQNDNGGKGAEVSVGWNIKENTEM
NT seq 492 nt   +upstreamnt  +downstreamnt
atgggcgtcgcaatgtttatgaaagtggacggcgtcaccggcgaatcggccgacgcgcag
cacaagggctggaccgacatccagtcgttctcatggggcgcgagccagccgggcgcgatg
gcgagcggcagcggcggcaacgcgggcaaggcgagcttcaacgatctcgtcgtcgccgcg
tacatggacaagggcgcaacggcgatcatcaagaactgcgcgagcggcaagcacctgccg
acggtcgagatatcggcgtgcaagacgggcggctcgcagatcgagttcatgcgcgtgacg
ctgcaggaagtgctcgtcacgtccgcgcagatcgcgggcgtcgacccgggcgacgcggcg
gaccggctgatgatgcagtacggttttcaggccgcgaaggtcaagaagcagtactggcag
cagaacgacaacggcggcaagggcgccgaagtgtcggtcggctggaacatcaaggagaac
accgagatgtga

DBGET integrated database retrieval system