KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2267
Entry
BP1026B_II2267    CDS       T02049                                 

Gene name
tssK-6
Definition
(GenBank) type VI secretion system
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II2267 (tssK-6)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II2267 (tssK-6)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFI70477
UniProt: A0A0H3I284
Position
2:complement(2817138..2818541)
AA seq 467 aa
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQ
IDRELLALGKVALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGA
QEVSFGAGGNGEGHGGDGNAHAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLES
ELTGDWQALGVARVVERRTDGRLLVDDGYIPPRLVAQRDPVLLRHTRELHGLLTQRSEAL
GERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAHPETLFCDWLKLACDLSTFT
AAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGNGMKVATIADP
ALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaacgagccggtattgtccgcgacccccgctgcggcgttgcgccagcgcgtgatctgg
accgagggcatgttcctgcggccgcagcatttccagcagctcgagcggcactgggagcgc
tacgtcggcatgcgctgcctgccgctgcaaggcttctactggggctacgacgagttgcag
atcgatcgcgagctgctcgcgctcggcaaggtcgcgctgctcgccgcgaccggcgtgatg
cgcgacggcacgccgttcgacctgtcgcatccggacgaccggcccgagccgctcgacgtg
cccgccgacgcgaaggatcagctcgtcgtgctcgcgctgccgctgtggcgcggcggcgcg
caggaggtgtcgttcggcgcgggcggcaacggcgaaggccacggcggcgacggcaacgcg
cacgcgggcttcgcgcgctacgtcgtgcgcgaatacgaagtcgccgacgcgaacgaggtc
gcgctcggccccgcgctattgcagaccggccgcctgaacgtgcgcctgatgctcgaatcc
gaattgacgggcgactggcaggcgctcggcgtcgcgcgcgtcgtcgagcggcgcaccgat
gggcggctgctcgtcgacgacggctacattccgccgcggcttgtcgcgcagcgcgatccg
gtgctgctgcgccacacgcgcgagctgcacgggctgctcacgcaacgcagcgaggcgctc
ggcgagcgcctgtcggagccggggcgcggcggcgtgtccgaagtcgccgatttcctgctg
ctgcaactcgtcaaccgctatctggcgctcacgtggcacgcgcagcaggatgtcgccgcg
cacccggagacgctgttctgcgattggctgaagctcgcgtgcgacctgagcacgttcacc
gcggccggccgccggccgcagtcgctcgcggtctaccggcacgacgatctgcgcgcgagc
ttcggcgagctgatggccgagctgcgccgctcattgtcgacggtgctcgagcagaacgcg
atccagatcgagttgcgcgacgtgggcaacggcatgaaggtcgcgacgatcgccgatccg
gcgctgcgcgacaccgcgggcttcgtgctcgccgtgcgcgccgacgtgccggccgacagc
ctgcgcgcgcgctttcccgcgcaggcgaagctcggtcccgtcgagcgcattcgcgatctc
gtgcagttgcaactgccgggcatcgcgatgcggcagttgcccgtcgcgccgcggcagatt
ccgtatcacgcgggccacacgtacttcgagatcgacaagggcggcgagatgtggaaacag
ctcgaacgctcgggcggcctcgcatttcatttcgccggcgaattcccgggactctcgatg
gagttctgggcgattcgcgggtga

DBGET integrated database retrieval system