KEGG   Bacillus amyloliquefaciens LL3: LL3_00333Help
Entry
LL3_00333         CDS       T01835                                 

Gene name
bsdB
Definition
(GenBank) phenolic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00130  Ubiquinone and other terpenoid-quinone biosynthesis
bql00627  Aminobenzoate degradation
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    LL3_00333 (bsdB)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LL3_00333 (bsdB)
Enzymes [BR:bql01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     LL3_00333 (bsdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEB61883
Position
347429..348007
Genome map
AA seq 192 aa AA seqDB search
MKLVIGMTGATGAIFGIRLLEYLKAAEIETHLVVSPWANVTITHETDYTLKDVEKLASYT
YSHKDQAAAISSGSFETDGMIIAPCSMKSLASIRTGMADNLLTRAADVILKERKKLVLLT
RETPLSQIHLENMLALTKMGSVILPPMPAFYNKPADMDELIDHIVFRTLDQFGIRLPEAK
RWYGIEKQKGGI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtcatcggaatgaccggggctacgggagccatattcgggatcaggctttta
gaatatttaaaggccgcggagatcgaaacccatcttgtcgtttctccttgggcaaatgtc
accatcacacatgaaaccgattatacgttaaaagatgtagagaaactggcgtcctatacg
tattctcacaaagaccaggcagcggcgatttcaagcggctcgtttgaaacggatgggatg
atcatcgctccgtgcagcatgaaatcacttgcaagcatccgcaccggaatggctgacaat
ctgctgacaagagcggctgacgtcatcctgaaagagcggaaaaaacttgtgcttctgacc
agagaaacgccgctcagccaaatccatttagagaatatgctagcgcttacaaaaatgggt
tccgtcattcttccgccgatgccggctttttacaacaaaccggctgacatggacgaattg
atcgaccacattgtgttccggacgctcgaccagttcggcatccgtctgccggaagcgaaa
cggtggtacggaattgaaaaacaaaaaggaggaatctga

DBGET integrated database retrieval system