KEGG   Bacillus amyloliquefaciens LL3: LL3_00531Help
Entry
LL3_00531         CDS       T01835                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00561  Glycerolipid metabolism
bql00640  Propanoate metabolism
bql01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LL3_00531
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LL3_00531
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     LL3_00531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 MMR_HSR1_Xtn DegS
Motif
Other DBs
NCBI-ProteinID: AEB62079
Position
515178..516311
Genome map
AA seq 377 aa AA seqDB search
MEDIKEGMMTLERIFISPAKYVQGKNAIETIGGHLEGVGEKAVVIADKTVWDIAGHKVTA
ELKKSNISSEEAVFNGEASQEEMKRIAGIAEKAGASIVIGVGGGKTLDTAKAVSDEINGY
TVIVPTAASTDAPTSGLSVVYSEQGAFENYRFYHKNPDLVLVDTKIVAEAPPRFLASGIA
DAMATWVEARSVIANGGKTMAGGIPTIAGEAIAEKCEEVLFKYGHLAYESVKAKVVTPPL
EAVVEANTLLSGLGFESGGLAAAHAIHNGFTALEGEIHHLTHGEKVAFGTLVQLALEKRS
LEEIERYIAFYISLGLPVTLEDIKLKDASKEDIMKVAEAATIEEETIHAAFDVTADDVAD
AIIAADQYAKAFKEKHA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcaaagaagggatgatgacattggaacgaatttttatcagtccggccaaa
tatgtgcaaggaaaaaacgcaattgaaacaatcggcggacatctggagggcgttggtgaa
aaagccgtcgtcattgccgacaaaaccgtatgggatatcgctggtcacaaagtgacggct
gaattaaagaaaagcaatatctcctctgaagaggcggttttcaacggagaagcttcccag
gaagaaatgaaaagaattgcgggcattgcagaaaaagcgggtgcgtccattgtgatcgga
gtcggcggcggtaaaacgcttgatacggccaaagccgtatcagatgaaataaacggctac
acggttatcgtgccgacggccgcttcaacggatgctccgacaagcggactgtctgtcgtt
tattcagaacaaggcgcgtttgaaaactatcgtttctaccataagaatcctgacctggtt
ctggtcgatacgaaaatcgtcgcggaagccccgccgcgttttttagcatcaggtattgcc
gatgcgatggcgacgtgggtagaggcgcgcagtgtcatcgccaatggcggtaaaacgatg
gcgggcggaattcctacaatcgcaggagaagccatcgcggaaaaatgtgaagaagtacta
ttcaaatatggccatctcgcctatgaatccgtaaaagcgaaagtcgtcactcctccattg
gaagcggtggttgaagccaatacacttctgagcggactgggatttgaaagcggcggcttg
gctgcggcgcatgccattcacaacggcttcaccgcgcttgaaggtgagatccatcacttg
actcacggtgaaaaagtggcattcggcacgctcgttcaactggcgctggaaaaacgttcg
cttgaagaaattgagcggtatatcgcgttttatatcagcttggggctgcctgtcacactt
gaagacatcaaattgaaagacgcatctaaagaggacattatgaaagtggcagaagccgca
accattgaagaagaaacgatacatgccgcttttgatgtcacggctgatgacgtggcagat
gccattatagcggccgaccaatacgcaaaagcgtttaaagaaaagcatgcgtaa

DBGET integrated database retrieval system