KEGG   Bacillus amyloliquefaciens LL3: LL3_00993Help
Entry
LL3_00993         CDS       T01835                                 

Gene name
yhcK
Definition
(GenBank) putative diguanylate cyclase or phosphodiesterase
  KO
K18967  diguanylate cyclase [EC:2.7.7.65]
Organism
bql  Bacillus amyloliquefaciens LL3
Brite
KEGG Orthology (KO) [BR:bql00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bql02000]
    LL3_00993 (yhcK)
Enzymes [BR:bql01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     LL3_00993 (yhcK)
Transporters [BR:bql02000]
 Other transporters
  Others
   LL3_00993 (yhcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF 5TM-5TMR_LYT TssN DUF3278 7TM-7TMR_HD
Motif
Other DBs
NCBI-ProteinID: AEB62535
Position
complement(946984..948066)
Genome map
AA seq 360 aa AA seqDB search
MLKELFLNLTILITFNYLFTLLFKESLSHKEDRPMFQLLKGTACGLLGVFLIAFGFSYSD
SIIDLRNIPIIIAALYGGWVSTAAAFMIIVAGRILINFNASAIFSIVAVGMIAILSVAVL
RGKKPDRKKAFVMLLFSNVIFTLTMLLLMPEQQPAGALVYYWLISTVGGMLSLYIIKHEA
DARLLFKQYKFQANYDFLTGIFNKRKFEEVSRVLYDRASQSASSQLALIYFDIDHFKQIN
DQYGHYEGDQVLKELGARLRFLISGSDPSARIGGEEFAVLIPNCTYKKGLHLAEEIRQAI
DGNPILLTSGDTIPVTVSLGIAHYPTNTADPQTLPLIADRLLYKAKTSGRNQVCSTEKKE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggaactgtttcttaatttgacgattttaatcacatttaattatctcttcacc
cttctttttaaagagtcgctttcgcataaagaagaccgtccgatgtttcaattactgaag
gggacggcctgcgggcttttaggggtttttctgattgctttcggcttttcttactccgat
tccatcattgatctcagaaatatccccattattattgccgctctttacggaggctgggtg
tctacggcagctgcctttatgattatcgtcgcaggccggatactgatcaatttcaatgcc
agcgccattttttccatcgtcgcagtcgggatgattgcgattctttctgtggccgtcctc
agaggaaaaaagccggatcgcaaaaaggcgttcgttatgctgcttttctcaaacgttatt
ttcaccttgacgatgctgttacttatgcctgaacagcagcctgccggggccctcgtttat
tattggctcatttccaccgtgggcggaatgctgtcactgtatatcatcaaacacgaagcc
gacgcccgccttttattcaagcaatacaagtttcaagcgaattatgattttctgacggga
atttttaataagagaaaatttgaggaagtctcgcgcgttctttacgaccgggcgtctcaa
tccgcctcatctcagctcgcgcttatttattttgatattgatcactttaaacagatcaat
gatcaatacggccattatgaaggcgatcaagtgctgaaggaactgggggcgcggctgagg
ttcttaatcagcggctctgatccgtcagcccggatcggcggcgaagaatttgccgtgctt
ataccgaattgcacatataaaaaagggcttcacctcgcagaagaaatcagacaggctatt
gacgggaacccgattcttttaacgagcggagatacaattcccgtgaccgtttccctcggc
atcgcgcattatccgacaaatacggcggatccgcagacattgcctctgatcgcagaccgg
ctgctgtacaaagcaaaaacatcgggacgcaaccaagtatgcagcactgaaaaaaaagaa
tga

DBGET integrated database retrieval system