KEGG   Bacillus amyloliquefaciens LL3: LL3_02102Help
Entry
LL3_02102         CDS       T01835                                 

Gene name
dhaS
Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00010  Glycolysis / Gluconeogenesis
bql00053  Ascorbate and aldarate metabolism
bql00071  Fatty acid degradation
bql00280  Valine, leucine and isoleucine degradation
bql00310  Lysine degradation
bql00330  Arginine and proline metabolism
bql00340  Histidine metabolism
bql00380  Tryptophan metabolism
bql00410  beta-Alanine metabolism
bql00561  Glycerolipid metabolism
bql00620  Pyruvate metabolism
bql00625  Chloroalkane and chloroalkene degradation
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_02102 (dhaS)
   00053 Ascorbate and aldarate metabolism
    LL3_02102 (dhaS)
   00620 Pyruvate metabolism
    LL3_02102 (dhaS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LL3_02102 (dhaS)
   00561 Glycerolipid metabolism
    LL3_02102 (dhaS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LL3_02102 (dhaS)
   00310 Lysine degradation
    LL3_02102 (dhaS)
   00330 Arginine and proline metabolism
    LL3_02102 (dhaS)
   00340 Histidine metabolism
    LL3_02102 (dhaS)
   00380 Tryptophan metabolism
    LL3_02102 (dhaS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LL3_02102 (dhaS)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LL3_02102 (dhaS)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LL3_02102 (dhaS)
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LL3_02102 (dhaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC PYNP_C MMS19_N
Motif
Other DBs
NCBI-ProteinID: AEB63639
Position
2046409..2047896
Genome map
AA seq 495 aa AA seqDB search
MSSLTMQITKRLETFLQGTKKLYIDGKFVPSASGATFVTPNPATGETLMTLYEAQAEDID
SAVKAARKAFDHGEWRTMPAASRSRLMYKLADLMEEHKTELAQLETLDNGKPINETTNGD
IPLAIEHMRYYAGWSTKITGQTIPVAGSYFNYTRHEPVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLTALYLAELIDQAGFPDGVINIVPGFGETAGEALTNHDDVDKL
AFTGSTEIGKKIMEKAAKNIKRVTLELGGKSPNIILPDANLKKAIPGALNGVMFNQGQVC
CAGSRVFIHKDKYDEVVSEMVSYAKSLRQGAGLHQDTQIGPLVSQEQHERVLSYIEKGKT
EGAKAVTGGSCPFEEGYFVSPTVFADVDDSMTIATEEIFGPVLAAIPYDTVDEVIERANR
SEYGLAAGLWTENVKNAHYIADRLQAGTVWVNCYNVFDAASPFGGYKQSGLGREMGSYAL
DNYTEVKSVWISLED
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttaacgatgcagatcacaaaaaggctggaaacatttttacagggcacgaag
aagctttatattgacggaaaatttgttccgagcgcttcaggagcaacatttgtcacgccg
aatccggcaaccggagaaacattgatgacgctttacgaggcacaggctgaagacattgac
agcgcagtgaaagctgcacgcaaagcctttgatcacggcgaatggcgcactatgccggcc
gcttccagaagcaggctgatgtataagcttgccgatttaatggaagagcacaaaactgaa
ctcgcgcagcttgaaacacttgataacggaaaaccgattaatgaaacgacgaatggagat
atcccgctggcaatcgagcatatgcgttattatgccgggtggtccacaaagataaccgga
caaacgatcccggtcgccggctcatattttaattacacccgccatgagcctgtcggcgtc
gtggggcaaatcatcccttggaacttcccgctccttatggcgatgtggaaaatgggcgcc
gcccttgccacaggctgcacaatcgttttgaaaccggcagagcagacacccctgaccgcc
ctctatttagcggaattaatagatcaggcgggcttccctgacggcgtcatcaatattgtt
cccgggttcggcgagacagccggggaagcgctgaccaaccatgacgatgttgataaactc
gcttttaccggttctacagaaatcggcaaaaagatcatggagaaagccgcgaaaaatatt
aagcgcgtaacgctggagcttggcggtaagtcacctaacatcattttacctgacgccaat
ttgaaaaaagccattcccggcgctttaaacggggttatgtttaatcaggggcaggtatgc
tgtgcaggctcccgtgtcttcattcacaaagacaaatatgatgaagtcgtaagcgaaatg
gtttcatatgcgaaatcacttcggcaaggagccggccttcatcaggatacccaaatcggg
ccgctcgtcagccaggaacagcatgagcgcgtgctttcttatattgaaaaaggaaaaacg
gaaggcgccaaagctgtcacaggcggaagctgcccgtttgaagaagggtattttgtctcc
ccgaccgtatttgcggatgtggatgacagcatgaccatcgcaacagaagaaattttcggc
ccggttttagccgccattccgtatgatacggttgatgaagttattgagcgggcgaaccgc
tcggaatacggccttgcagccggactatggaccgagaatgtgaaaaacgcccattacatt
gctgaccgtctacaggccggcaccgtttgggtcaactgctacaatgtttttgatgcggcg
tcacctttcggcggctataagcaatccggcctcggacgggaaatgggctcttatgcgctg
gataattatacagaagtgaaaagcgtctggatcagtctggaagattga

DBGET integrated database retrieval system