KEGG   Bacillus amyloliquefaciens LL3: LL3_02603Help
Entry
LL3_02603         CDS       T01835                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00071  Fatty acid degradation
bql00072  Synthesis and degradation of ketone bodies
bql00280  Valine, leucine and isoleucine degradation
bql00310  Lysine degradation
bql00362  Benzoate degradation
bql00380  Tryptophan metabolism
bql00620  Pyruvate metabolism
bql00630  Glyoxylate and dicarboxylate metabolism
bql00640  Propanoate metabolism
bql00650  Butanoate metabolism
bql00900  Terpenoid backbone biosynthesis
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
bql01212  Fatty acid metabolism
bql02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LL3_02603 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    LL3_02603 (mmgA)
   00640 Propanoate metabolism
    LL3_02603 (mmgA)
   00650 Butanoate metabolism
    LL3_02603 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LL3_02603 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    LL3_02603 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LL3_02603 (mmgA)
   00310 Lysine degradation
    LL3_02603 (mmgA)
   00380 Tryptophan metabolism
    LL3_02603 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LL3_02603 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LL3_02603 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LL3_02603 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bql04147]
    LL3_02603 (mmgA)
Enzymes [BR:bql01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LL3_02603 (mmgA)
Exosome [BR:bql04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LL3_02603 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AEB64136
Position
complement(2462315..2463496)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAGISESEAEGAVMGMVVQAG
AGQIPARQAARHAGLPWSVPAETINKVCASGLRAVTICDQIIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSSAAKKYGISRDEQDHYAL
LSQKRAAEAAETGKLHEEIVPVTWTGKKGKQHTVAADEGLRPDTSLDQLAKLKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LKKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggctagaacgccgttcggaaaattcggcggggca
ttaaaagaggtaaaagcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccggcatcagtgaaagtgaagcagaaggtgcggtgatgggaatggtcgtccaggcgggc
gcggggcagattccggcgcggcaggctgcgaggcatgccgggcttccatggtccgttccg
gctgaaaccattaataaggtctgtgcatcggggctcagagccgttaccatctgtgatcaa
atcatccgggcgaaagatgcggacgtgctgattgcaggcggtatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggagacggggtttttcag
gatttaatggttcatgacgggctgacctgtgcgtttgatcaggtgcatatggctgtccac
ggaagctctgcggccaaaaagtacggcatttcccgagatgaacaggatcattacgctctt
ttaagccagaaacgcgcggctgaggcagctgagacgggtaaattgcatgaagaaatcgtc
cccgtcacctggaccggcaaaaagggcaaacagcatactgttgcagcagatgaggggctg
cgtccggatacaagccttgaccagctcgcaaagctcaaacctatttttacagccgacgga
acggtcaccgccggaaacgctcccggtgtaaatgacggcgccggagcatttgtgctgatg
tcggaggaaaaagccgcgaagcagcatgtcagaccgctcgctgcgatacttggttttgcg
tctgtcggactggaagcgtccgagcttgcaagcgcgccgggagaagccatcagccggctc
ttgaaaaaaaccggtttgtccgttgacgacatcgatttgtttgaagtgaatgaagcattt
gcgtccgtcgtcctcgtgagcgaaaaaatagccgggttcagccgggagaaagtgaatgtt
aacgggggggcaattgcgttcggccatccgatcggcgcaagcggagccagaatcatcatg
agtttgatatacgaattaaagcggcgcggcggaggtttaggcatagcggcaatatgcagc
ggagcggctcaaggagacgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system