KEGG   Bacillus amyloliquefaciens LL3: LL3_02682Help
Entry
LL3_02682         CDS       T01835                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00010  Glycolysis / Gluconeogenesis
bql00052  Galactose metabolism
bql00500  Starch and sucrose metabolism
bql00520  Amino sugar and nucleotide sugar metabolism
bql00521  Streptomycin biosynthesis
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
Module
bql_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bql_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_02682 (glcK)
   00052 Galactose metabolism
    LL3_02682 (glcK)
   00500 Starch and sucrose metabolism
    LL3_02682 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LL3_02682 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LL3_02682 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LL3_02682 (glcK)
Enzymes [BR:bql01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LL3_02682 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AEB64215
Position
complement(2520656..2521618)
Genome map
AA seq 320 aa AA seqDB search
MEETWFAGIDLGGTTIKLAFINMYGEIQHKWEVPTDKSGNTITVTIAKALDQKLEELNKP
KRIVKWIGMGAPGPVEMATGMVYETTNLGWKNYPLKDHLEAETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIVNGEIVHGKNGAGGEIGHICSIPEGGAPCNCGKS
GCIETIASATGIVRIAKEKLAAVSDSSLLQVRDLTARDVFEAAKQQDKTALEVVDYVAKH
LGLVLGNLASAMNPTKIVLGGGVSKAGEILRSKVEETFKITAFPRSAEAADISIAALGND
AGVIGGAWIAKNEWLKYQNC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaagagacatggtttgcggggattgatcttggcggaacaaccatcaagctggccttt
atcaacatgtacggtgaaattcagcacaaatgggaggttccgaccgataaatcaggaaac
acaattacggtcacgatcgctaaagcacttgaccagaaactcgaagaattgaataagccg
aaacggatcgtaaaatggatcggcatgggagcgcccggacccgtggaaatggcgacgggg
atggtttatgagacgacaaatctggggtggaaaaactatcccttgaaagaccatctcgag
gcggaaacgggtattccggccgtcattgaaaacgatgccaatatcgcggcgctcggagaa
atgtggaaaggtgcaggcgacggagctaaagatgtcattttagtgacgcttggaaccgga
gtcggcgggggcatcatcgtcaacggagaaatcgttcacggtaaaaacggggcaggcgga
gaaatcggtcatatttgcagtatcccggaaggcggggctccgtgcaactgcggaaaatcc
ggctgtattgaaacgattgcgtcagcaaccggcatcgtccgcatcgcgaaagaaaagctt
gcagcggtttccgactcttcgctcctgcaagtgcgcgatctcacggcacgtgacgtgttc
gaagcggcaaaacagcaggataagacagcgctggaagtcgtcgattatgtcgcaaaacat
ttaggccttgtgctcggaaacctggcaagcgccatgaacccgactaaaatcgtgctcggc
ggaggcgtctcgaaagcaggagaaatactgcggtcaaaagtggaagagaccttcaaaatc
accgcgttcccgcgttctgcggaagcggccgatatttcgattgcggcacttggaaatgac
gccggagtcatcggcggggcgtggattgccaaaaatgaatggcttaaatatcaaaactgc
tag

DBGET integrated database retrieval system