KEGG   Bacillus amyloliquefaciens LL3: LL3_02800Help
Entry
LL3_02800         CDS       T01835                                 

Gene name
yrhJ
Definition
(GenBank) putative bifunctional P-450/NADPH-P450 reductase 2
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00071  Fatty acid degradation
bql00380  Tryptophan metabolism
bql00627  Aminobenzoate degradation
bql01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    LL3_02800 (yrhJ)
  Amino acid metabolism
   00380 Tryptophan metabolism
    LL3_02800 (yrhJ)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LL3_02800 (yrhJ)
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LL3_02800 (yrhJ)
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     LL3_02800 (yrhJ)
Cytochrome P450 [BR:bql00199]
 Cytochrome P450, bacteria type
  CYP102 family
   LL3_02800 (yrhJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: AEB64332
Position
complement(2620330..2623491)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLGKALLKVREFGGDGLFTSWTNEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEEMNALVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLEKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIEKGQPVTILT
PQLHRDKSAWGEDAELFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHSDYELTIKEALTIKPGDFKIRVKNKDVSNRQTAQNHKAEGSDHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQKIPRLIDKVLEEKGATR
LTSIGEGDNADDFEYSQEAWEDSFWQDIIKAFHIEAAPEQQNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSTRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIH
RFALDPNQHFKISGRHLPHLPMDRPVNALELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDETAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ANSGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQNGDHAVCFIRSPQSGFALPENTKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDQAEKTG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLSWLEQLQAEGRYAKDVWAGV
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgcaataccgcagccgaaaacatacggccctctgaaaaatctccct
cacttggaaaaagaaaagctttcacaatcgctttggaaaatagcggaggaatacggcccg
atctttcgttttgaattcccgagctctgtcggggtcttcgtatcaggccgcgagctcgca
gcagaagtctgtgatgagaagcgatttgacaaaaacctcggcaaagctttgctgaaagtc
cgtgaatttggcggtgacggattatttacgagctggacaaacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagtcagaaagcaatgaaaggctatcattcaatg
atgcttgatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgtcgctgaagatatgacgcgcctgacgctggataccatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagcatgctt
cgtgcgctgcaggaggccatgcgccaatctcaacggcacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagagatgaatgcgcttgtagaccgg
atcattgctgagcggagggaaaatccggatgagaatctgtctgatcttttggcattgatg
cttgaagccaaagaccctgtaacgggtgaaaggctggatgatgaaaatatccgctatcaa
attattacctttttgatcgctgggcatgaaacgacaagcgggctgctttcttttgcgata
tactgcctgctgaaaaataaagataaattggaaaaagccgttcaggaagccgaacgggtg
ctgacgggagaaacccctgaatataagcagattcagcagctgacctatatccgcatggtg
ttaaacgaaacattgcggctttatccgactgccccggcattttctctgtacgcgaaggaa
gatacggttctcggcgggaaatatccgattgagaaaggacagcccgtgacgattctgact
ccgcagctgcaccgtgataaaagcgcgtggggagaagatgccgagttattccgccctgaa
aggttcagtgatcccgcggccattccggctgatgcgtataagccgttcggaaacggacag
cgcgcctgcatcgggatgcagtttgcccttcaggaagcgacgatggtgctcggtcttgtc
cttaagcattttgaactgattgatcattctgattatgagcttacgattaaagaagcttta
accattaagcccggcgattttaaaatccgggtgaaaaacaaggacgtgtccaatcggcag
accgcacagaaccataaagctgaaggaagcgatcacaaagaagaaacgaaagaaataccg
tcccacggaaccccgcttctcatcctttacggatcaaatttaggaactgcggaaggaatt
gcggaagagctggctgacatcggaagaagcaaaggcttttcaactgaaaccgggccgctc
gatgattatgccgggaaattgcctgtaaaaggcgctgtcgtgattgtaacggcttcttac
aacggggcgccgcctgataacgcggcgggttttgtcaagtggatggaaactcttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaattgggccgcc
acctaccagaagattccccgtcttatagacaaagtgcttgaagaaaaaggagcaacacgg
cttacctctatcggagagggtgacaatgccgatgattttgagtacagtcaggaagcttgg
gaagattcattttggcaggacatcatcaaggcttttcatatagaagccgctcccgaacag
caaaacaaatcacagctatcaatagaatatgtaagtgaagcagctgagacgccgattgcc
aaaacgtacaaagcgtttgaggcggaagtcatcacaaacaaagagcttcataccgaaagc
agcacgcgatcagtccggcacattgagctgcgtctcccggaaacagaaacttatcaggaa
ggagaccatctcggggtgcttccgcaaaacagcggggaactgatcagccgcgtcattcac
cggttcgctctcgatccgaatcagcactttaaaatcagcggacggcatttacctcatctg
ccgatggaccggccggttaatgcactggagcttttggcgtcatatgtagaactgcaggaa
ccggccacgagagcccagcttcgagaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgaaacggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggatctgctggaagattatccggcatgtgaattgccgttcgagcgc
tttttagaacttttgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaacagcggggaactcagtatcacagtcggcgttgtaacggctccggcttggagcggc
cggggagaatatcgcggtgttgcttcgaactacttagccggattacagaatggcgatcat
gccgtctgtttcatccgctcaccgcaatccggttttgcactgcctgaaaatacgaaaacg
cctctcattatggtcggagcgggcactggaatcgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtccggtaacagcctgggggaagctcatttatactttggctgc
agacatcctgaagaagatgatctctacaaagatgaattcgatcaggcggagaaaacaggc
cttgtcaccgtgcatcgggcgtattcaaggttagatcaggactgtaaagtatacgtacag
gatgtcctgcttcgtgaggccgcacagattattgcgcttcttgaccaaggcggccatctc
tatatatgcggtgacggaagcaaaatggctccggccgtggaaaatgtcctgctgcaggcg
tatgaaaaggtgcataacactgattcgaaagtttccttgagttggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtgtgggcaggtgtgtaa

DBGET integrated database retrieval system