KEGG   Bacillus amyloliquefaciens LL3: LL3_03104Help
Entry
LL3_03104         CDS       T01835                                 

Gene name
melA
Definition
(GenBank) alpha-D-galactoside galactohydrolase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00052  Galactose metabolism
bql00561  Glycerolipid metabolism
bql00600  Sphingolipid metabolism
bql01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LL3_03104 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LL3_03104 (melA)
   00600 Sphingolipid metabolism
    LL3_03104 (melA)
Enzymes [BR:bql01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LL3_03104 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C CW_7
Motif
Other DBs
NCBI-ProteinID: AEB64635
Position
2914174..2915472
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNTS
VSIISYDDRKQALKQAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHNDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQIKNWETIRDGIINNQ
NLTHERSNEYGSRIIEAMETGRPFMFGGNVLNTGLIPNLPAKAVVEVPCAAVKNQIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDWLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcgggaagcacgatatttgcgaaaaatgtactggga
gactgtttactgactgaagctttaaacggatttgaattcgcgctttatgatattgatgct
gtacggctgaaagaatcccagctcatgctggaaaacatgagagaccgctataatacgagc
gtatccatcatttcttacgatgaccgaaaacaggcgctaaaacaggccggctatgtgata
aacgccattcaggtcggcggttataaacccgcgacggtcattgactttgacatccctaag
cggtacggcctgcgccagacgattgccgataccgtcggaataggcggcattttccgttcc
cttcgcaccatccccgttttatttgacatcgctaaagacatggaagaggtctgtccggat
gcgtggctgttaaactatacaaatccgatggcttctctgaccggcgcgatgctcagacat
acaaatgtaaaaacggtcggcctgtgccacagcgtacaggtctgtacaaaagatctgttt
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcatcaatcacatg
gcttggctcttagagatcaaaaaagacggaattgatttgtatccggaaattaaaagacgc
gcccgcgagaaacaaaagacgaaacataatgacatggtgcggtttgagctgatggataag
ttcggctgctacgtaacggaatcatctgagcacaatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccagatcccgctagatgaatatccgaga
agatgcgcagaacaaatcaaaaactgggaaacgataagagacggcatcatcaacaatcaa
aacctgacgcatgagcgctcgaatgaatacggttcgagaattatagaagcgatggagacg
ggccgtccgtttatgttcggcggcaatgtgctgaatacgggactcataccgaatctgccg
gcgaaagcagtcgttgaagtgccttgcgcagccgttaaaaatcaaattatgccttgttat
tcaggcgaacttccggaacagctcgcggcgcttaacagaacaaacattaatacacagctt
ttaaccatcgaagcggccgttactttaaaaaaggaagccgtatatcaggcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatctctttgtgcgatgattta
tttgaagcccataaagactggcttccggcgtatcactga

DBGET integrated database retrieval system