KEGG   Bacillus amyloliquefaciens LL3: LL3_03135Help
Entry
LL3_03135         CDS       T01835                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00010  Glycolysis / Gluconeogenesis
bql00020  Citrate cycle (TCA cycle)
bql00620  Pyruvate metabolism
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
Module
bql_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_03135 (pckA)
   00020 Citrate cycle (TCA cycle)
    LL3_03135 (pckA)
   00620 Pyruvate metabolism
    LL3_03135 (pckA)
Enzymes [BR:bql01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     LL3_03135 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_16 AAA_33
Motif
Other DBs
NCBI-ProteinID: AEB64666
Position
2944660..2946243
Genome map
AA seq 527 aa AA seqDB search
MKLVDLTADLQALLASPNVHHNLSAPKLTEKVISRNEGTLTSTGAVRATTGAYTGRSPKD
KFIVREKSTENQIDWGAVNQPISEEAFEKLYAKVVSYLKQRDELFVFEGFAGADEKYRLP
ITVVNEFAWHNLFARQLFIRPETNEKDPQAQPFTILSAPHFKADPETDGTHSETFIIVSF
EKRVILIGGTEYAGEMKKSIFSIMNFLLPQQDILPMHCSANVGEKGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDSGVFNIEGGCYAKCINLSEEKEPQIFHAIRFGSVLENVVL
DEKTGEADYDNSFYTENTRAAYPIEMIGNIVQPSIAGHPQAIVFLTADAFGVLPPISKLT
KEQAMYHFLSGYTSKLAGTERGVTSPQTTFSTCFGSPFLPLPAHVYAEMLGKKIDEHGVQ
VFLVNTGWTGGGYGVGERMKLSYTRAMVKAAIDGTLDQTDMTADSIFGLHSPVHVPGVPD
EVLQPENTWSDKKAYNEKALFLANEFKENFKKFSHADSIAKAGGPLV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttgatttaaccgcagatcttcaagcgttactcgcaagtccgaatgtgcat
cataatttatcagctccaaaacttactgaaaaagtgatcagccgaaatgaaggaacgctg
acatcaacaggcgccgtacgcgccactaccggcgcatatacgggccgatcacctaaagat
aaatttatcgttcgtgaaaaaagcacagaaaatcaaattgattggggcgcggtgaaccag
cccatttctgaagaagcgtttgaaaagctgtacgccaaagtcgtcagctacttaaaacag
agagatgaactgtttgtttttgaaggattcgcaggcgcagatgaaaaatacagactgccg
attacagtcgtaaatgaatttgcgtggcataatttattcgcgcgccagctgtttatcaga
ccggagacgaatgaaaaagatccgcaagcacagccgtttaccattctttcagctccgcat
tttaaagctgatccggaaacggacggcacgcattctgaaacatttattattgtatccttc
gaaaagcgcgtcattttaatcggcggcaccgagtacgccggagaaatgaaaaaatcaata
ttctcgattatgaactttctgctcccgcagcaggatattctgccgatgcactgctcagcc
aacgtcggtgaaaaaggcgatgtcgccctgtttttcggtctttccggcactgggaaaacg
acgctttcagccgatgcggaccggaaactgatcggcgatgacgagcacggctggtctgat
tccggcgtttttaacattgaaggcggatgttacgctaaatgtatcaatctgagcgaagaa
aaagaaccgcagatttttcacgcgatccgcttcgggtctgttcttgagaatgttgtgctt
gatgagaaaacgggtgaggcggattacgacaattccttctacacggaaaacacaagagcc
gcatatccgattgagatgatcggcaatatcgtgcagcctagcattgccggccacccgcag
gcgatcgtctttttaacggcggatgcattcggtgtgctccctccgatcagcaaactgacg
aaggagcaggcgatgtatcatttcttaagcgggtacaccagcaaacttgccggaaccgaa
cgcggtgtgacatctccgcaaacgactttttccacgtgcttcggttcaccgttcctgccg
cttccggctcacgtatatgccgaaatgctcgggaagaaaatcgacgaacacggcgttcaa
gtctttctggtcaacacaggctggaccggcggagggtacggagtcggagagcggatgaaa
ctttcgtatacaagagcgatggtcaaagccgcaattgacggcacgcttgatcagacagac
atgacagcagacagcattttcggtctgcacagccccgttcatgttccgggcgttccggat
gaggttcttcagcctgaaaacacatggagcgataaaaaagcatacaacgaaaaagcgctg
tttttagccaatgagttcaaagaaaactttaaaaagttttcccatgcagactccattgcc
aaagccggcggacctctcgtttaa

DBGET integrated database retrieval system