KEGG   Bacillus amyloliquefaciens LL3: LL3_03538Help
Entry
LL3_03538         CDS       T01835                                 

Gene name
tpiA
Definition
(GenBank) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00010  Glycolysis / Gluconeogenesis
bql00051  Fructose and mannose metabolism
bql00562  Inositol phosphate metabolism
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
bql01230  Biosynthesis of amino acids
Module
bql_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bql_M00002  Glycolysis, core module involving three-carbon compounds
bql_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_03538 (tpiA)
   00051 Fructose and mannose metabolism
    LL3_03538 (tpiA)
   00562 Inositol phosphate metabolism
    LL3_03538 (tpiA)
Enzymes [BR:bql01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LL3_03538 (tpiA)
Exosome [BR:bql04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LL3_03538 (tpiA)
  Exosomal proteins of bladder cancer cells
   LL3_03538 (tpiA)
  Exosomal proteins of melanoma cells
   LL3_03538 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB65066
Position
complement(3322249..3323010)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKNSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKVVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaactctcggcgaggctgtc
agcttcgttgaagaagtgaaaaattccattccagcagcagacaaagcggaagccgttgtt
tgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaactgacttaaaa
gtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggcgaaatcagcccg
gtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgctttcaaacacggc
attgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccggaaaaacaaat
gatcttgttgccgatcaagtgaaaaaaggtcttgcgggtctttctgaagagcaagttgca
gcttccgttattgcgtacgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcaaacgacgtctgcgcgcatatccgcaaagttgttgctgaaagcttcagccaa
gaagctgctgacaagctccgcattcaatacggcggcagcgtaaaacctgcaaatattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagccttgaaccg
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system