KEGG   Bacillus amyloliquefaciens LL3: LL3_03638Help
Entry
LL3_03638         CDS       T01835                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00520  Amino sugar and nucleotide sugar metabolism
bql01100  Metabolic pathways
bql01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LL3_03638 (nagA)
Enzymes [BR:bql01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LL3_03638 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AEB65165
Position
3413025..3414215
Genome map
AA seq 396 aa AA seqDB search
MAESLLISGADIVTEDEIIQNGFLGIKDGIISYAGKTRPQETYEKEWKAPEGTYALPGMI
DIHIHGGYGADTMDADFAALDTMAARLPEEGTTSFLATTITQQHENIEKALENAKEWTAS
SPQAHKGAELIGIHLEGPFVSPEKAGAQPKQWITPADTGLFQKWEHLSGGLIKIVTLAPE
EDPDFSLIRYLKDRNIIPSMGHTNAGADLLEKAADAGALHMTHLFNAMSCFHHREPGGIG
TALACGRITAELITDGIHSHPLAVKLAFLAKGSQNLVMITDSMRAKGLKDGEYEFGGQKV
TVRGNTALLPDGTLAGSILKMNEGAALMRRFTNCSWLDIANMTSANAARRLGIFDRKGSI
AEGKDADVILTDGQCGVLASICRGNTAYISKEADWA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagcttgttaatcagcggtgcggacatcgtaacagaagatgaaatcatccaa
aacggatttctcggcataaaagacggcatcatttcttacgcgggtaaaacaagaccgcaa
gaaacgtatgagaaggaatggaaggcgcccgagggcacgtatgcgcttcccggaatgatt
gatatccatattcacggcggatacggcgcggatacgatggatgccgatttcgcggcgctt
gatacaatggccgcccggctgcccgaagaaggaacaacctcttttttagcgacaacaatt
acacagcagcacgaaaatattgaaaaagcgctcgaaaacgccaaagaatggacggcatct
tcacctcaggcgcataaaggcgctgagttgatcgggattcatttagaagggcctttcgtc
tctccggaaaaggcgggagcacagccgaaacaatggattaccccggccgataccgggctc
tttcagaaatgggaacatctttctggagggctgatcaaaattgtgacgcttgcgccggaa
gaagatcctgatttcagcctgatccgttatttaaaagaccggaacatcatcccctcaatg
ggacatacaaacgcgggagccgatcttttagaaaaagcggcggatgccggagcgctgcat
atgacgcatctcttcaacgccatgagctgctttcatcaccgtgagccggggggcatcggt
acggctctcgcctgcggccgcatcacggcggagctgatcactgacggtattcattcccat
cctttagccgtaaagcttgcctttttggcgaaaggaagccaaaacctggtgatgattaca
gactccatgcgggcaaaagggctgaaggacggagaatacgaattcggcggacaaaaagtc
accgttcgcgggaacacggcgcttcttcctgacgggacgctggccggttccattttaaaa
atgaatgaaggcgcagcgctcatgcgcaggtttacaaactgttcatggctggatatagca
aatatgacgtcggcaaatgcagcccgccgcctcggcatatttgaccgcaaaggaagcatt
gcggaaggaaaagacgccgacgttatactgacggacggacagtgcggcgtgctggcatcc
atttgccgcggaaacaccgcatatatttcaaaggaggctgattgggcatga

DBGET integrated database retrieval system