KEGG   Bartonella quintana RM-11: RM11_0212Help
Entry
RM11_0212         CDS       T02294                                 

Definition
(GenBank) hypothetical protein
  KO
K08738  cytochrome c
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RM11_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Tad
Motif
Other DBs
NCBI-GeneID: 13564338
NCBI-ProteinID: AFR25955
Position
283047..283586
Genome map
AA seq 179 aa AA seqDB search
MNRSTVAYFIFACLFLLIILVGISTLSNMVYDHSALVQPAYKVTKSDVLKKKQLTSDISL
SLNDRLQQGNLENGRKIFRQCALCHTSRQNEVGRVGPALWGVVDRPLAATTGFAYSRVLR
ANSDKRWDFVTLDRYLQSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSDHPVSLPMR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttcgacagttgcctattttatttttgcttgtctatttttgctgattattttg
gtgggaatttctacactcagcaacatggtttatgatcactctgcattggttcaacctgct
tataaggttacaaaaagtgatgtgctcaagaaaaaacagctgacatctgatatttctttg
tcattgaacgatcgtcttcaacaaggaaatcttgaaaatgggcgtaagatttttcgtcag
tgtgctctctgccatacctcgagacagaatgaagttggccgtgttggtccagcactttgg
ggggtagttgaccgtcctttggcggctacaacaggttttgcttattcacgtgtactgcgt
gcaaattctgataagagatgggattttgtgactttggatcgttatctgcaatctccacgt
gaagcgtttccaggaacaattatgtcttttcgtggaattaaaaatgatcaagatcgtgct
gatcttttgctttatttacgcagtttgtccgatcatcctgtttctttgccgatgcgataa

DBGET integrated database retrieval system