KEGG   Bartonella quintana RM-11: RM11_0733Help
Entry
RM11_0733         CDS       T02294                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00270  Cysteine and methionine metabolism
bqr00280  Valine, leucine and isoleucine degradation
bqr00290  Valine, leucine and isoleucine biosynthesis
bqr00770  Pantothenate and CoA biosynthesis
bqr01100  Metabolic pathways
bqr01110  Biosynthesis of secondary metabolites
bqr01130  Biosynthesis of antibiotics
bqr01210  2-Oxocarboxylic acid metabolism
bqr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RM11_0733
   00280 Valine, leucine and isoleucine degradation
    RM11_0733
   00290 Valine, leucine and isoleucine biosynthesis
    RM11_0733
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RM11_0733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bqr01007]
    RM11_0733
Enzymes [BR:bqr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     RM11_0733
Amino acid related enzymes [BR:bqr01007]
 Aminotransferase (transaminase)
  Class IV
   RM11_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 13563606
NCBI-ProteinID: AFR26455
Position
919955..921061
Genome map
AA seq 368 aa AA seqDB search
MKSPTSSISFKIEKHPSPLSDEKRESILKNPGFGRFFTDHMGIIKWTKDKGWHNAVISQY
KSLEINPASTVLHYAQEIFEGLKAYRAKDGRILLFRPDANAQRFIESARRLAMPELPKDI
FLDAIHQLVRIDQKWVSGNPNASLYIRPFMFGNQNFLGVRPSEEYLFCIIASPVESYFKG
EEKPISVWIETDHSRAGPGGTGAAKCGGNYAASLLAQKNATENNCSQVLFLDMIEHKWIE
ELGGMNVCFIMADNTLVTPALNGTILPGITRHSILKLAQQMGLMIEERPYSFESLQEDAH
KGHLKEVFACGTAAVVTSIGRFKYKGGEFIIGNEMIGKITQKIRTQLVDLQKGNIEDKNG
WVHFVQLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcctacatcatcaatttcgtttaaaatagaaaaacacccatcacctttatca
gacgagaaacgtgaaagtattctaaaaaatcctggttttggccgattttttacagatcac
atggggatcattaaatggaccaaagataaaggttggcataacgctgtcatctctcaatac
aaatccctagaaattaatccagcaagtaccgttttgcattatgcgcaagagatttttgaa
ggtttaaaagcctatcgcgcaaaagatggacgcattttgttattccgccctgatgccaat
gcgcaacgttttatagagtcggcaagacgattagccatgccagaattaccaaaggacatt
tttttagatgccattcatcaattagtaagaattgatcagaagtgggtttctggaaatccc
aatgctagcctctacatacgtccattcatgtttggcaatcaaaattttttgggagttcgc
ccttctgaagaatatcttttctgtatcatagcatctcctgttgaatcatatttcaaagga
gaagaaaaacctatcagtgtatggattgaaacagatcatagccgagctggtccaggggga
accggtgctgcgaaatgtggtggaaactatgcagcaagcttacttgcacaaaaaaatgca
actgaaaacaattgtagccaagtgctttttcttgatatgattgaacataaatggattgaa
gagcttggtggtatgaatgtttgctttattatggcagataatacacttgtaacacctgca
cttaatggcaccattcttccaggaataacacgtcattcaattttgaaattggcgcaacaa
atgggtttaatgatagaagaacgcccttattcttttgaatcgctccaggaagatgcacac
aagggtcatcttaaagaagtttttgcttgtggtactgccgctgttgtcacatcaatcggt
cgcttcaaatataaaggtggagagttcataattggaaatgaaatgatcggtaagattacg
caaaaaattcgtacacaattggttgaccttcaaaaaggaaatatagaagataaaaatggc
tgggtacattttgtccagctttcataa

DBGET integrated database retrieval system