KEGG   Bartonella quintana RM-11: RM11_0739Help
Entry
RM11_0739         CDS       T02294                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00020  Citrate cycle (TCA cycle)
bqr00480  Glutathione metabolism
bqr01100  Metabolic pathways
bqr01110  Biosynthesis of secondary metabolites
bqr01120  Microbial metabolism in diverse environments
bqr01130  Biosynthesis of antibiotics
bqr01200  Carbon metabolism
bqr01210  2-Oxocarboxylic acid metabolism
bqr01230  Biosynthesis of amino acids
Module
bqr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bqr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RM11_0739
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RM11_0739
Enzymes [BR:bqr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RM11_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP IDH
Motif
Other DBs
NCBI-GeneID: 13563612
NCBI-ProteinID: AFR26460
Position
926009..927223
Genome map
AA seq 404 aa AA seqDB search
MVKIKVQNPIVEIDGDEMTRIIWKYIKDKLIHPYLDIDLKYYDLSVENRDTTNDQVTIDS
ANAIKKYGVGIKCATITPDEARVKEFNLKKMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPNWTKPIIIGRHAFGDQYKATDFKFPGKGKLSIKFIGDDNQVIEHDVFDAPSAGVAMAM
YNLDESICDFARASFNYGLQRNVPVYLSTKNTILKSYDGRFKDIFQEIFDAEFKAEFENR
KLHYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKI
VEAEAAHGTVTRHYRQYQKNEETSTNSIASIFAWTRGLTHRAKLDNNEKLKNFATTLEEV
CIKTVEEGFMTKDLALLIGPKQKWLSTTGFLDKIHENLKKAMGN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagatcaaagtgcaaaaccccattgttgaaattgatggggatgagatgacccgt
atcatctggaaatatatcaaagacaaactgatccatccttatctcgacattgaccttaaa
tattacgatctttctgtcgaaaatcgagatacaaccaatgatcaagtaactatcgattct
gcgaatgctatcaaaaaatatggggttggtataaaatgtgcaaccatcacgcctgatgaa
gcacgagtcaaagagtttaacctaaaaaaaatgtggaaatcacccaatggcacgatccgc
aatattttagggggagtcatttttcgcgaaccgattatctgcaaaaatgtcccacgtctc
gttcctaactggaccaaaccaattattatcggacgtcatgcttttggtgatcagtataag
gcaactgatttcaaatttcctggcaagggaaagttaagtattaaatttatcggcgatgac
aatcaagttatcgaacatgatgtttttgacgccccaagtgcaggggtcgccatggctatg
tataaccttgatgaatcaatttgtgattttgctcgagcatcttttaattatggactacag
cggaatgttccagtctatctttcaacaaaaaacaccatactgaaatcttatgatggccgt
tttaaagatatctttcaagaaatattcgatgctgaatttaaagctgaatttgaaaatcgt
aaattacattacgaacaccgcctcattgatgacatggttgcttctgcacttaaatggtca
ggtggctacgtgtgggcatgtaaaaattatgatggtgatgttcagtccgatatcgttgct
caaggctttggttcccttggtcttatgacttctgttctcatgacaccagacggtaaaatt
gttgaagcagaagctgcacacggtacagtgacacgccattaccgtcagtatcaaaaaaat
gaagaaacatcaacaaattctattgcatctatttttgcatggacacgtggcctgacgcat
cgtgccaaacttgataacaatgagaaattaaaaaactttgccacaacattggaagaagtt
tgtattaagactgttgaagaaggttttatgaccaaagatctcgcacttttgattggacct
aaacaaaaatggctttctacaacaggcttcctcgataaaattcatgaaaatctcaaaaaa
gcaatgggtaattaa

DBGET integrated database retrieval system