KEGG   Bartonella quintana RM-11: RM11_0741Help
Entry
RM11_0741         CDS       T02294                                 

Definition
(GenBank) hypothetical protein
Organism
bqr  Bartonella quintana RM-11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-GeneID: 13563614
NCBI-ProteinID: AFR26462
Position
complement(931215..931463)
Genome map
AA seq 82 aa AA seqDB search
MVYLHHLIKSGESLGGMLLTWNNLFIVKNLCKEFVKPLKQAVMLTFVLKHALYGHKGDKV
LALLWSLPFPGCSIYFCIKNFY
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
gtggtttatttgcatcatttgattaaatctggtgaatctctcggtggtatgttgttaact
tggaataatctttttattgtcaaaaacttatgtaaggaatttgtgaagccattgaagcag
gctgttatgctgacttttgtgctgaaacatgcgctttatggacacaagggcgataaagta
ttggctttattatggagtttaccttttccaggttgctcaatttatttttgtatcaaaaac
ttttattaa

DBGET integrated database retrieval system