KEGG   Bartonella quintana RM-11: RM11_0758Help
Entry
RM11_0758         CDS       T02294                                 

Definition
(GenBank) recombination factor protein RarA
  KO
K07478  putative ATPase
Organism
bqr  Bartonella quintana RM-11
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    RM11_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgsA_C AAA_assoc_2 AAA RuvB_N AAA_5 AAA_22 Mg_chelatase AAA_16 Sigma54_activat AAA_18 ResIII Sigma54_activ_2 AAA_3 AAA_33 AAA_14 AAA_28 TIP49 AAA_30 RNA_helicase IstB_IS21 AAA_24 AAA_25 Cytidylate_kin AAA_11
Motif
Other DBs
NCBI-GeneID: 13563631
NCBI-ProteinID: AFR26479
Position
complement(952940..954259)
Genome map
AA seq 439 aa AA seqDB search
MSKDFFTSSFDLQVNKKRPLPERMRPRSLKDVTGQNHLLGEKGLLSRMVVAGSIGSMIFW
GPPGTGKTTVARLLALEKKFAFEQVSAIFTGVSELKKIFEVAQARFMSGCKMLLFVDEIH
RFNRAQQDSFLPFMEDGTVILIGATTENPSFELNAALLSRARVLTFLPHDNESLSMLLKR
AEKVEGKILPLDDDARDVLIGMSDGDARAALTLAEEVWSVAQPGEIFDAGTLQKIIQRRA
PIYDKGRDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYIGRRLVRMAVEDVGL
ADPQALVICNAAKDAYDYLGSPEGELALAQACLYVATAPKSNATYLAYKAAMHSARKNGS
FPPPRHILNAPTKFMKEEGYGHGYRYDHDEPDAFSGQEYFPEQLGQQIYYQPRERGFERE
IAKRLEWWKQLRKKRGNQK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaggatttttttacttcgtcttttgatcttcaggttaataaaaaacggccgctt
ccagaaagaatgcgccctcgctctcttaaagatgtaacgggacaaaatcatctgcttgga
gagaaaggtttgctttcacgcatggtggtggctggctcaattggttcgatgattttctgg
gggcctccaggaacaggaaaaacgacagttgcacgtttgttagcacttgaaaaaaaattc
gcttttgagcaagtttctgctattttcactggggtttctgagcttaagaaaatttttgaa
gttgctcaagcgcgttttatgtctggatgtaaaatgcttttgtttgtcgatgaaattcat
cgctttaatcgtgcgcaacaggatagttttcttccgtttatggaggatggtactgtaatt
cttattggtgcaacgacagaaaacccttcatttgaacttaatgctgcacttctttctcgc
gcacgtgttttgacatttcttccacatgacaatgaaagtttgagtatgcttttgaaacgc
gctgaaaaagtagaaggaaagattcttcccttggatgatgatgccagagatgtgttaata
ggaatgtctgacggtgatgcacgggcagcgttaacattggcagaggaagtttggtctgtt
gcacagccgggtgagatattcgatgctggtaccttgcaaaaaattattcagcgtcgtgct
ccaatttatgataaggggcgagatggtcattataatctcatttcagccttgcataaatcc
gttcgtggatctgatcctgatgctgctctttattatttagcacgtatgtttgacgcgggg
gaagatcctttatacattgggcgaagattggttcgtatggctgttgaagatgtcggttta
gcagatccgcaagctcttgttatttgtaatgcggcaaaagacgcttatgattatttagga
tcacctgagggagaattggctttggcgcaagcgtgtctttatgttgcaactgcaccaaaa
tcaaatgcaacatatctcgcgtataaggcagctatgcatagtgcacgtaaaaatggttct
tttcctcctcctaggcatatccttaatgcgcctacaaaatttatgaaagaagaagggtat
gggcatggttatcgctatgatcatgatgaaccagatgctttttcaggacaggaatatttt
cctgaacagcttgggcagcagatctattatcaaccacgagaacggggttttgaacgtgag
attgcgaagcgtcttgagtggtggaagcaattgcgcaaaaagcgaggcaatcaaaagtga

DBGET integrated database retrieval system