KEGG   Bartonella quintana RM-11: RM11_0762Help
Entry
RM11_0762         CDS       T02294                                 

Definition
(GenBank) 30S ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr03010  Ribosome
Module
bqr_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RM11_0762
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bqr03011]
    RM11_0762
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    RM11_0762
  Bacteria
    RM11_0762
  Archaea
    RM11_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S11 Ribosomal_L18p FLYWCH_u
Motif
Other DBs
NCBI-GeneID: 13563635
NCBI-ProteinID: AFR26483
Position
complement(957491..957880)
Genome map
AA seq 129 aa AA seqDB search
MAKQATRVRRRERKNILSGVVHINSTFNNTMVTITDAQGNAIAWSSAGAQGFKGSRKSTP
FAAQVAAEDCARKAQEHGMRSLEVEVCGPGAGRESALRALQSVGFVITSIRDVTPIPHNG
CRPRKRRRV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcaagccacacgtgtgcgtcgtcgcgagcgcaaaaatattttatccggtgtt
gtgcatatcaattcaacatttaacaatacaatggttactattactgatgctcagggaaat
gcgattgcgtggtcgtctgctggtgctcagggttttaaaggatcacgtaaatctacccct
tttgcagctcaggttgccgcggaagattgtgctagaaaagcgcaggaacatggtatgcgt
tcattagaagttgaggtttgtggtcctggggcaggtcgtgaatctgctctacgtgcgtta
cagtctgttggttttgttattacttctattcgtgatgtaacgccaattcctcataatgga
tgtcgtccacggaaaaggcgacgtgtttaa

DBGET integrated database retrieval system