KEGG   Bartonella quintana RM-11: RM11_0764Help
Entry
RM11_0764         CDS       T02294                                 

Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00230  Purine metabolism
bqr00730  Thiamine metabolism
bqr01100  Metabolic pathways
bqr01110  Biosynthesis of secondary metabolites
bqr01130  Biosynthesis of antibiotics
Module
bqr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RM11_0764
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RM11_0764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bqr04147]
    RM11_0764
Enzymes [BR:bqr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     RM11_0764
Exosome [BR:bqr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RM11_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 Hydin_ADK AAA_18 AAA_33 Zeta_toxin Cytidylate_kin Thymidylate_kin AAA_28 ABC_tran AAA Glutaminase AAA_22
Motif
Other DBs
NCBI-GeneID: 13563637
NCBI-ProteinID: AFR26485
Position
complement(958553..959131)
Genome map
AA seq 192 aa AA seqDB search
MRVVFLGPPGSGKGTQARMLTEEYRIPQLSTGDMLREVISRETEVGRKAKAIINAGALVS
DSIVNQIVSNRINESDCINGFVLDGYPRTVGQAEVLQQILQSKNMQLDAVIELIVDENAL
IERMKKRVQETIAVGGRVRSDDNHVAFAKRLVEYREKTAPLSKFYSERGLLKVVDGMMAV
TEVSRVIRGFFK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgtttttttagggcctcctggatctgggaaaggtacacaagctaggatgttg
actgaggaatatcgtatccctcagttatcaacaggcgatatgttgcgtgaagttattagc
agagaaacggaagttggcagaaaagctaaagctattataaatgcaggtgctttggtctct
gatagcattgttaatcaaattgtatcgaatcggattaatgaaagcgattgcataaacggt
tttgtcttggatgggtatccgcgcactgtagggcaggcagaggttttgcaacagatttta
cagtcaaaaaatatgcagcttgacgctgttattgagctgattgttgatgaaaatgcgttg
attgagcgaatgaagaaacgtgttcaggaaacaatagctgtgggtgggcgggtccgctct
gatgataatcatgttgcttttgcaaaacgattagtggaataccgtgagaaaacagcacct
ttatcgaaattttattcagagaggggattgttaaaggttgttgatggcatgatggctgtt
actgaggtatcacgggtgattagagggttttttaaataa

DBGET integrated database retrieval system