KEGG   Bartonella quintana RM-11: RM11_0780Help
Entry
RM11_0780         CDS       T02294                                 

Definition
(GenBank) 50S ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr03010  Ribosome
Module
bqr_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RM11_0780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bqr03011]
    RM11_0780
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    RM11_0780
  Bacteria
    RM11_0780
  Archaea
    RM11_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Motif
Other DBs
NCBI-GeneID: 13563653
NCBI-ProteinID: AFR26501
Position
complement(967382..968215)
Genome map
AA seq 277 aa AA seqDB search
MAFKHFNPTTPGQRQLVIVDRSCLYKGKSVKALTAGLSSKGGRNNHGRVTARFQGGGHKR
SYRFVDFKRLKRGVFAKVERLEYDPNRTAFIALIRYEDGQLSYILAPQRLDVGDSIIAGS
NVDVKPGNAMPLGNMPVGTIIHNVEMKPGKGGQIARSAGTYAQLVGRGQGMVILRLNSGE
QRLVSGSCFATVGAVSNPDHANINDGKAGRSRWRGKRPHVRGVAMNPVDHPHGGGEGRTS
GGRHPVSPWGKSTKGKRTRSNKATDKFIMHTRHQRKK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaagcactttaatccaactacgcccgggcagcgtcagcttgttattgtagat
cgttcttgtctttataaggggaagtctgtaaaagctttaactgcaggtttgtcatcgaaa
ggtggacgtaataatcatggtcgtgttactgctcgttttcagggcggtggtcataaacgc
agttatcggtttgttgattttaaacgtcttaaacgtggtgtttttgcaaaagttgagcgt
ttggaatatgatccaaaccgcactgcttttattgctttaattcgttatgaagatgggcaa
ttaagttatattcttgcaccacaacgtcttgatgttggcgattctattatagcaggttca
aatgttgatgttaagccaggaaatgccatgcctcttggcaacatgccagtggggacgatt
attcataatgttgaaatgaaacctggaaaaggtggtcaaattgcccgttcagctggcact
tatgcgcagttggttggacggggtcagggaatggttattcttcgtcttaattctggtgaa
cagcggttggtatctggtagttgttttgcaactgttggtgctgtttcaaatcctgatcat
gcaaatattaatgatggtaaagcaggaaggtcacgttggcgtggcaagcgtccgcacgtt
cgtggtgttgctatgaatccagttgatcatccacatggtggtggtgaaggtcgtacctca
ggagggcgtcatccagtgtctccttggggtaagtctacaaaaggtaagcgtacgcgctct
aataaagccactgataaatttattatgcatacgcgtcatcagcgcaagaaatga

DBGET integrated database retrieval system