KEGG   Bartonella quintana RM-11: RM11_0785Help
Entry
RM11_0785         CDS       T02294                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bqr  Bartonella quintana RM-11
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bqr03012]
    RM11_0785
   03029 Mitochondrial biogenesis [BR:bqr03029]
    RM11_0785
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bqr04147]
    RM11_0785
Translation factors [BR:bqr03012]
 Eukaryotic Type
  Elongation factors
   RM11_0785
 Prokaryotic Type
   RM11_0785
Mitochondrial biogenesis [BR:bqr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RM11_0785
Exosome [BR:bqr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RM11_0785
  Exosomal proteins of breast cancer cells
   RM11_0785
  Exosomal proteins of colorectal cancer cells
   RM11_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 13563658
NCBI-ProteinID: AFR26506
Position
complement(970302..971486)
Genome map
AA seq 394 aa AA seqDB search
MDEKWRAQMAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEER
ARGITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTR
EHILLARQVGVPAIVVFLNKVDQVDDAELLELVELEIRELLSKYDFPGDDIPIVKGSALA
ALEDKDKSIGEDAVRLLMSEVDNYIPTPERPVDQPFLLPIEDVFSISGRGTVVTGRVERG
VIKVGEEIEIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGIERGQVLAK
PGSVTPHTRFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGIEMVMPGD
NVAMDVSLIVPIAMEEKLRFAIREGGRCWCRYRF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttggacgaaaaatggagagctcaaatggcaaagagcaaatttgaacgtacgaagccgcat
gttaatattggtacgattggtcacgttgaccatgggaagacctcattgacagcagcgatt
acgaaatattttggtgaatttaaagcttatgaccaaattgatgcggcacctgaggagcgt
gcacgtggaattactatttctacggcgcatgttgaatatgagacagagaagcggcactat
gcacatgttgattgtcctgggcatgcggattatgtgaagaacatgattacgggagcggca
cagatggatggggcgattttggttgtttctgccgctgatggtccgatgcctcagactcgt
gagcatattttgcttgcgcgtcaggtgggtgttccggcaattgttgtttttcttaataaa
gttgatcaagttgatgatgctgaacttttggagcttgttgagcttgagattcgggagctt
ttatcaaaatatgattttccaggagatgatatcccaatagttaaaggatctgcgttggcg
gcacttgaagataaagataaaagcattggtgaagatgcggttcgtcttttaatgagtgaa
gttgataattatataccgacgcctgagcgtcctgttgatcaaccgtttttgttaccgatt
gaagatgttttttcgatttccggtcgtggaactgttgtgactggtcgtgttgagcgtggt
gttattaaagttggtgaggaaattgagattatcggcattcgtccaacgtctaagacgaca
gttacaggggttgagatgttccgcaagcttttggatcaaggtcaagccggtgataacatt
ggtgcactgcttcgtggtgttgatcgtgaagggatcgagcgtggtcaagttttggcgaag
cctggttcggttacccctcatactagatttaaagcagaggcttacattttaacgaaagat
gaaggtgggcgtcatactccattttttacgaattatcgtcctcagttttacttccgtacc
acggatgtgaccggaattgttacgcttccagaaggtatagagatggttatgcctggcgat
aatgtcgctatggatgtctctttgatcgttccgattgcaatggaagaaaaacttcgcttt
gctattcgtgaaggggggcgctgttggtgcaggtatcgtttctaa

DBGET integrated database retrieval system