KEGG   Bartonella quintana RM-11: RM11_0787Help
Entry
RM11_0787         CDS       T02294                                 

Definition
(GenBank) 30S ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr03010  Ribosome
Module
bqr_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RM11_0787
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bqr03011]
    RM11_0787
Ribosome [BR:bqr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    RM11_0787
  Bacteria
    RM11_0787
  Archaea
    RM11_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7
Motif
Other DBs
NCBI-GeneID: 13563660
NCBI-ProteinID: AFR26508
Position
complement(973638..974108)
Genome map
AA seq 156 aa AA seqDB search
MSRRHRAEKREINPDPKFGDLVITKFMNAIMFDGKKSVAERIVYGALDVVESKVKSDPVV
LFHQALENVAPHIEVRSRRVGGATYQVPVDVRPDRRRALAVRWLITAARGRNETTMINRL
AGELMDAANNRGSAVKKREDVHRMAEANRAFSHYRW
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcgccatagagcagaaaaacgtgaaattaatccagatcctaaatttggtgat
ttggtcattacgaaatttatgaatgccattatgtttgatggtaaaaagtccgttgctgag
cgtattgtttatggtgcgcttgatgttgtagaaagtaaggtgaagtcagatccggtggtt
ttgtttcaccaggcgctggagaatgttgcccctcatatcgaggttcgttcgcgtcgcgtt
ggtggtgccacttatcaggttcctgttgatgttcgtcctgatcgtcgtcgagctcttgct
gtccgctggttaattacggcggcacgtggacgtaatgagacgacaatgattaatcgtctt
gctggtgaattgatggatgctgctaataatcgcggttctgcagtgaagaagcgtgaggat
gttcatcgtatggctgaggctaatcgtgcattctctcattatcgctggtag

DBGET integrated database retrieval system