KEGG   Bartonella quintana RM-11: RM11_0790Help
Entry
RM11_0790         CDS       T02294                                 

Definition
(GenBank) amino-acid ABC transporter binding protein
  KO
K10001  glutamate/aspartate transport system substrate-binding protein
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr02010  ABC transporters
bqr02020  Two-component system
Module
bqr_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RM11_0790
  09132 Signal transduction
   02020 Two-component system
    RM11_0790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bqr02000]
    RM11_0790
Transporters [BR:bqr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    RM11_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 NMT1 Phosphonate-bd NMT1_3 TDH
Motif
Other DBs
NCBI-GeneID: 13563663
NCBI-ProteinID: AFR26511
Position
975947..976858
Genome map
AA seq 303 aa AA seqDB search
MKKSLSIFTAVTVTVMGLIGIAKAENDTLEKIKKTGEITLGVRESSGLAYALGNGKYVGF
HTEMAERIIDDISKKIGKPIKIHYLPITSQNRIPLLKNSTYDFECGSTTNDVSSSKEAAF
AYTTYVEDVRIAVKKNSNIKSFDDLNGKTVATTTGTTSVQIIRKNQRSKNINFNVVKGKD
HGDSFLLLESGRADAFIMDASILAGHIAKSKNPSDYIILDTVLSVEPIACMLRLNDKNLK
QAINDSIVRQIKDESLKKLHDKWFMKPTPPANIIINLPLSEATKYAWEHPNDKPRENYTE
NNL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcactttcaatattcactgcagtaactgtaaccgttatgggactgataggt
attgcaaaagccgaaaatgatacacttgaaaaaattaaaaaaacaggagaaattactcta
ggtgttcgcgaatcatcgggtttagcttatgctcttggaaatgggaaatatgtgggattc
cacacagaaatggcagagcgtatcattgatgacatttcaaaaaaaattggtaaacccatt
aaaattcattatctccccattacatcacaaaatagaattcctcttttgaaaaacagcact
tatgattttgaatgtggctcaacaacaaatgatgtttccagcagtaaagaagcagcattt
gcttataccacttacgtcgaagacgttcgaattgccgtaaagaagaattctaatattaaa
tcctttgacgatctaaatggaaaaacagtcgcaaccacaaccggtacgacatctgttcag
attatccgtaaaaatcaacgttcaaaaaacattaactttaatgttgtgaagggaaaagat
catggagatagcttcttattattagaatctggccgtgcagacgcatttattatggacgct
tcaattcttgctgggcatattgccaaatcaaaaaatccatctgattatatcattcttgat
actgtgctttcagtcgagcccatcgcttgcatgctcagattaaatgacaaaaacctcaaa
caagcaatcaacgatagtatagtacgtcaaattaaagatgaatcgcttaaaaagcttcat
gataagtggtttatgaaaccaactccgcctgctaatattattattaatcttcctttatct
gaagcaacaaaatacgcttgggagcacccaaacgataaacctcgcgaaaactacacagaa
aataatttgtag

DBGET integrated database retrieval system