KEGG   Bartonella quintana RM-11: RM11_0793Help
Entry
RM11_0793         CDS       T02294                                 

Definition
(GenBank) glutamate/aspartate transport ATP-binding protein
  KO
K10004  glutamate/aspartate transport system ATP-binding protein [EC:3.6.3.-]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr02010  ABC transporters
bqr02020  Two-component system
Module
bqr_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RM11_0793
  09132 Signal transduction
   02020 Two-component system
    RM11_0793
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bqr02000]
    RM11_0793
Enzymes [BR:bqr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     RM11_0793
Transporters [BR:bqr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    RM11_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase Rad17 AAA_16 AAA_22 AAA_33 AAA_15 Mg_chelatase ATPase_2 AAA_23 AAA_18 T2SSE AAA_30 AAA AAA_24 RNA_helicase AAA_25 IstB_IS21 PRK cobW ATP_bind_1 G-alpha FtsK_SpoIIIE NACHT Septin NB-ARC NTPase_1 AAA_19 DEAD RNA12 AAA_28
Motif
Other DBs
NCBI-GeneID: 13563666
NCBI-ProteinID: AFR26514
Position
978521..979255
Genome map
AA seq 244 aa AA seqDB search
MIEIKNVSNWYGEINILKNCTTNINKGEVVVVCGPSGSGKSTLIKTINALVPFQKGEIWI
DGVPVHSKKTNLSKLRSHVGMVFQHFELFPHLSVTENLTIAQIKVLKRSKKEALERGLLY
LERVGLTEHKNKYPGQLSGGQQQRVAIARALTMDPLVMLFDEPTSALDPEMVGEVLDVMI
SLAEEGMTMICVTHEMGFAQKVSERVIFMDQGRILEDCSSKEFFSVPQARTPRAQEFLSK
ILNH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaataaaaaatgtctcaaactggtatggcgaaattaatattcttaaaaactgt
acaaccaatatcaataaaggagaagttgttgtagtttgtgggccatcaggttcaggtaaa
tcaacgctcattaaaactattaacgctttagtacctttccaaaaaggtgaaatttggatt
gatggagtaccggttcattcgaaaaagacaaatctgtctaaattgcgtagccacgtaggg
atggtatttcaacatttcgagcttttccctcatttatctgtcacagaaaatttaacaatt
gcacaaatcaaagttctaaaacgtagcaagaaagaagcacttgaacgcggcttgttatat
cttgaacgcgttggacttactgaacataaaaataaatatcccggccaactttccggaggt
caacaacaacgtgttgcgattgcacgcgccttaactatggatccactcgttatgcttttt
gatgagccaacatctgctctagatcctgaaatggtaggtgaagtactagatgtcatgatc
agcttagcagaagaaggtatgacaatgatttgtgtcacgcatgaaatgggatttgctcaa
aaagtctcggagcgtgttattttcatggatcaaggaagaattctcgaagactgttcatcc
aaagaattcttttctgtcccacaagccagaacaccacgtgcccaagaatttttgtctaaa
atcctcaaccattaa

DBGET integrated database retrieval system