KEGG   Bartonella quintana RM-11: RM11_0794Help
Entry
RM11_0794         CDS       T02294                                 

Definition
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00970  Aminoacyl-tRNA biosynthesis
Module
bqr_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RM11_0794
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bqr01007]
    RM11_0794
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bqr03016]
    RM11_0794
Enzymes [BR:bqr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     RM11_0794
Amino acid related enzymes [BR:bqr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RM11_0794
Transfer RNA biogenesis [BR:bqr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RM11_0794
 Prokaryotic Type
    RM11_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1f tRNA-synt_1_2 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 13563667
NCBI-ProteinID: AFR26515
Position
complement(980696..983419)
Genome map
AA seq 907 aa AA seqDB search
MLEKNYDAASIEQKIAKRWEARGAFKAGMGAKSGAEPFCVMLPPPNVTGSLHMGHALNTT
IQDIVVRFERMRGKNVLWQPGMDHAGIATQTVVERQLAECQEPTRQEMGRERFVERIWEW
RHETGGIIANQLRRLGVSCDWSRERFTMDEGLSHAVREVFVTLYKQGLIYKDKRLVNWDP
KLLTAISDLEVEQREIKGHLWHFRYPLEGKVFDPGDPTTFITVATTRPETMLGDTGIAVN
PEDDRYKNLIGQSALLPLVGRRLLIVADSYADPSEGSGAVKITPAHDFNDFEVGKRNNLR
LINIFTQKAEIFLHKNEAFFDGLTLSDELKKLVENLDQADRFVARHQIVSLMEEGGYLAA
VDDHPHTVPHGDRSGVPIEPFLTDQWYVRAEQLAKPAVEAVRQGRTQFVPDSWKKTYFNW
MENIQPWCISRQLWWGHQIPAWYGPDGMVFVEKSEEEALAAAFSHYGEEVELTRDQDVLD
TWFSSALWPFSTLGWPNKTTELDTFYPTSLSVTGFDIIFFWVARMMMMGLHFMGEVPFPT
VYVHALVRDQKGAKMSKSKGNIIDPLELIDQYSADSLRFTLAVMAAQGRDVKLDPSRIAG
YRNFATKLWNATRFAKINGVKHNPAFKPEKVKLALNRWILTELSKTVSAVTTGIENYKFN
ESADALYRFIWNTLCDWYLELLKPVFQSFNGEAKNEAQACTAWVLDEVYKLLHPFMPHMT
EELWCLTETPNMQRKDMLALTQWPEITFLDEAAAADINWLIDVITEIRSVRFEMNIPAGK
LAPLVIVEAGEITRERIQRYGALLKKLARIETIDFSDKVLALSAQMVLGEAIFCLPLGQL
IDLEAERARLVKNVSKIEQDIEKISVKLNNPKFVENAKPEIVEAERNKILEFRVAQKKIS
IALERLG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaaactatgatgctgcttccatagagcaaaagattgcaaaaaggtgggaa
gctcgtggtgcttttaaagcaggaatgggcgcaaaaagtggtgcagaacctttttgtgtt
atgcttccgcctcccaatgttacaggctcacttcatatggggcatgcactcaatacgaca
attcaagacattgtcgtccggtttgagcggatgcgtggcaagaatgttttgtggcagcct
ggcatggatcatgcagggattgctacgcaaacggttgttgagcgtcagcttgcagagtgc
caagagccaacacgtcaagaaatgggcagagaaagatttgttgagcgtatttgggaatgg
cgtcatgagactggtggaattattgccaatcaactacggcgccttggtgtttcatgtgat
tggtcacgcgaacggtttacaatggatgaaggtttgtcccacgctgttcgtgaggttttt
gttacgctttataagcaagggttgatatataaggataagcgtctcgttaattgggatccc
aaattattaacggctatttctgatcttgaagttgagcaaagagaaattaaaggtcatttg
tggcattttagatatcctcttgaaggtaaagtttttgatcctggtgatcctacaactttt
ataacagtggcaacaacacgcccggaaacaatgcttggtgatacggggattgcggttaat
cccgaagatgatcgttataaaaatcttataggtcaaagtgctcttttgccgcttgttggt
cggaggttattaattgttgctgatagttatgctgaccctagcgaaggaagcggggcagtg
aaaattacaccagcgcatgattttaatgactttgaggttggaaagcgcaacaatttacgt
ttgatcaatatttttacgcaaaaagctgaaatttttttgcataagaatgaagcgtttttt
gatggtttaactttatccgatgaattaaagaaattagtggaaaatttagatcaagctgat
cgctttgtcgcacgtcatcaaattgtttctttgatggaagaaggagggtatttagcagcc
gttgatgatcatccacataccgttcctcatggggatcgtagtggggtgcctattgagccg
tttttgacagatcaatggtatgttcgtgctgaacaattagctaagccagcggtagaggcg
gttcgtcaaggaagaacacaatttgttccagatagctggaaaaaaacttattttaattgg
atggaaaatattcaaccttggtgtatctctcgtcaattatggtggggacatcagattcca
gcctggtatggtcctgatggtatggtttttgttgaaaaaagtgaagaagaggctttagcg
gcagctttctctcattatggtgaagaagttgaattaactcgtgatcaggatgttttagat
acgtggttttcatcagctctttggcctttttcaacgctgggttggcccaataaaacgact
gaattagatactttttatccaacatctttatcggttacgggatttgatattattttcttt
tgggttgctcgcatgatgatgatggggcttcactttatgggtgaggttcctttcccaacg
gtttatgtacatgctcttgtgcgtgatcaaaaaggggcaaagatgtcaaagtcgaagggc
aatattattgatccattagagcttattgatcaatatagcgcagattcgctccgttttact
ttggctgttatggcggcacaaggccgtgatgtaaaacttgatccttcccgtattgcagga
taccgtaattttgctacaaaattgtggaatgctactcggtttgcaaagataaacggcgtt
aagcataatccggcttttaagccagaaaaagtcaagcttgcacttaaccgttggatttta
acagaattatctaaaactgtttcggcagtgactaccggtattgaaaactataagtttaat
gagtctgctgatgcactttaccgcttcatttggaatacattatgtgattggtatctggaa
cttctcaaacctgtctttcaaagtttcaatggggaggctaaaaatgaagctcaggcatgt
actgcttgggttttggatgaagtttataagcttcttcatccttttatgcctcatatgaca
gaagagttatggtgcctcacagaaacaccgaatatgcagcgtaaagatatgctggcctta
acacaatggccagaaataacgtttttagatgaagcagctgctgctgatattaattggctt
attgatgttattactgagattcgttctgtacgcttcgaaatgaatattccggcgggtaag
cttgctcctcttgttattgtagaagcgggggaaataacgcgagaacgtattcagcgttat
ggggctcttttaaaaaagttagcacgtattgaaacaattgatttctctgataaagtacta
gctttatcggcacaaatggttttaggagaggcaattttttgtttaccattggggcagttg
attgatttggaagctgaacgtgctcgtttggtgaaaaatgtcagtaaaattgaacaagat
attgaaaaaatatcggttaaactaaacaatcccaaatttgtagaaaatgcaaaaccagaa
attgttgaggctgagcgtaacaagattttagaattccgtgttgcacagaagaaaatatct
attgctttagagcggttggggtaa

DBGET integrated database retrieval system