KEGG   Bartonella quintana RM-11: RM11_0807Help
Entry
RM11_0807         CDS       T02294                                 

Definition
(GenBank) potassium-efflux system protein
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
bqr  Bartonella quintana RM-11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N IlvN AdoHcyase_NAD Sacchrp_dh_NADP F420_oxidored NAD_binding_2 Gp_dh_N DAO 3HCDH_N ApbA Shikimate_DH Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 13563680
NCBI-ProteinID: AFR26525
Position
997270..999024
Genome map
AA seq 584 aa AA seqDB search
MLHDTPLITTIVAGLCLAFLLGMVASRLRISPLVGYLLAGVLVGPNTGGFRIDSSIINQL
AEIGVILLMFGVGLHFSLKDLLSVKAIAIPAALAQMAFSTFLGLCLGLIMGWGFSSSLVF
GLALSTASTVILLRALQERHLIETEKGRIAVGWLIIEDLAMVLILVLIPSLANILGNTKK
KVIDPVIKWLDPSIWGVFGLTILKVIVFIILMLVIGRRIIPWLLKVSAQSGSRELFRLSV
FATALGVAFGAAHLFGVSLSLGAFFAGMVMSESELSHRAAEESLPLRDAFSVLFFVSVGM
LFDPGKILSHFFPLLATLLIIIIGKSAVAFFIVKALRHSNAIACTISASLAQIGEFSFIL
ASLSLNLGFLNNDAHDLILGGAILSILLNPLVFIAFDKIKKHLENFLTNPQDVQTIIDID
LKDPDQEFLPITSKTNHIVIIGYGRIGKCVALSLINKGELVVIVEESKRLADKAIADGLE
VICGNIIKQDIMSAANISNAYKVVITMRSTIEVGECIVNIRNMKKDIQIITHALSDVETA
YLIDLGADIVVTDDEEIANGIIEYITGQKSVKNMHNYELNLQKT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgctccatgatacaccacttattacaacaattgtagcaggtttatgcttagcatttctt
ttgggaatggttgcgagtcgtttgcgtatctcacccctcgtgggatacttgttagctggt
gttcttgtaggaccgaacacaggcggttttaggatagattccagtattattaaccaactc
gcagaaattggtgtcattttgctgatgtttggtgttggactgcatttttcattaaaagat
ctcttatccgtcaaagctattgctatccctgctgcccttgcacaaatggcattttctact
tttctgggcctatgcctcggactgattatgggatggggattcagtagcagtttagtcttc
ggtttagctttatcaacagcaagtactgttattctgctgcgtgctttgcaagaacgccat
cttattgaaacagaaaaaggacgtattgctgttggttggttgattattgaagatttagcg
atggttcttatacttgttctcataccatcattggcaaatatccttggcaatacgaaaaag
aaagtgattgatcctgttattaaatggttggacccaagtatttggggagtttttggtctc
accatcctaaaagttattgtatttatcatcctcatgctcgtgattggccgacgcattatc
ccgtggttattaaaagtgagtgcacagtcaggatcacgtgaattatttcgtctgagtgtc
tttgctactgcattaggagtagctttcggagctgctcatttatttggtgtttctctttct
cttggtgccttttttgcaggtatggttatgagcgaatcagaattgagccatcgtgcagcg
gaagaatccttacctctgcgagatgcattttctgttctcttttttgtttctgtaggcatg
ttatttgacccagggaaaatactgagtcatttttttcctctcttagcaacattattaatt
attataataggaaaatctgctgttgccttttttatcgttaaagctcttcgccactctaat
gcgatagcttgcaccatttctgccagccttgcccaaatcggagaattctcttttatcctt
gcaagtttaagtttaaaccttggattcttaaataacgatgctcatgaccttatccttgga
ggtgcaattctttccattttactcaatcccctcgtttttattgcctttgacaaaattaaa
aagcatctagaaaattttcttacaaacccacaagacgtacaaacaatcattgatattgat
ctgaaggatcctgaccaagagtttttaccaattacctcaaaaacaaaccatattgtaatt
atcggttacggccgtattggtaaatgtgttgcattatctttaataaacaaaggtgaactt
gtagtgatcgtggaagaatcaaaacgccttgctgataaagcaattgcagatggtttagag
gtaatttgcggcaatatcattaaacaagatatcatgagtgccgcaaatattagcaatgcc
tacaaagttgttattacaatgcggagcactattgaagtaggagaatgtatagtgaatata
cggaatatgaagaaggatatccagataatcacgcatgcattatccgatgtagaaacggct
tatctcattgatttaggtgcagatattgtagtaactgatgatgaagaaatcgcaaatggt
attatcgagtatataactggacagaaatctgtaaaaaatatgcacaattatgaattaaat
ttacagaaaacataa

DBGET integrated database retrieval system