KEGG   Bartonella quintana RM-11: RM11_0816Help
Entry
RM11_0816         CDS       T02294                                 

Definition
(GenBank) hypothetical protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00290  Valine, leucine and isoleucine biosynthesis
bqr00650  Butanoate metabolism
bqr00660  C5-Branched dibasic acid metabolism
bqr00770  Pantothenate and CoA biosynthesis
bqr01100  Metabolic pathways
bqr01110  Biosynthesis of secondary metabolites
bqr01130  Biosynthesis of antibiotics
bqr01210  2-Oxocarboxylic acid metabolism
bqr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RM11_0816
   00660 C5-Branched dibasic acid metabolism
    RM11_0816
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    RM11_0816
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RM11_0816
Enzymes [BR:bqr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     RM11_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 13563689
NCBI-ProteinID: AFR26533
Position
complement(1012114..1012644)
Genome map
AA seq 176 aa AA seqDB search
MILQRLLAFTPAQSGCPGSVLVDIPKDIQFASGIYRAHQELTFMRSYPKLKEDTTAIEHA
VSRLAEEKCPVIYSGGGVISSGLEAAKLLRDLVRLGDFPITSTLMGLGAYPASDKDWLGM
LEMHGIYEANLAVIVMLCWLLVRGLMIVYHWGGLMRLHLMRALSILIFIILVSIRS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgcaaagattattagccttcactcctgctcaatcaggatgtccaggatcagtt
ttggttgatattcctaaagatattcaatttgcttcgggtatttatagagcacatcaagag
ttgacatttatgcgttcttatccaaaactaaaagaggatacaacagctatcgaacatgct
gtttctcgcttagcagaagaaaaatgtcctgttatttattctggtggtggtgttatttca
tcaggtcttgaagctgcaaagctcttgcgcgatttggttcgattgggggattttccgatt
acttcaacactcatgggacttggtgcttatccagcttctgacaaagattggcttggaatg
cttgagatgcatggaatttatgaagcgaatttagctgtgattgtgatgttatgttggctg
ttggtgcgcggtttgatgatcgtatatcactggggcggcttgatgcgtttgcacctcatg
cgcgcgttatccatattgatatttatcattcttgtatcaataagatcgtaa

DBGET integrated database retrieval system