KEGG   Bartonella quintana RM-11: RM11_0817Help
Entry
RM11_0817         CDS       T02294                                 

Definition
(GenBank) tRNA delta(2)-isopentenylpyrophosphate transferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr01100  Metabolic pathways
bqr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bqr01006]
    RM11_0817
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bqr03016]
    RM11_0817
Enzymes [BR:bqr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     RM11_0817
Prenyltransferases [BR:bqr01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   RM11_0817
Transfer RNA biogenesis [BR:bqr03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    RM11_0817
 Prokaryotic Type
    RM11_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPPT IPT Cytidylate_kin Hydin_ADK AAA_24 AAA_33 CobU Zeta_toxin AAA_14
Motif
Other DBs
NCBI-GeneID: 13563690
NCBI-ProteinID: AFR26534
Position
complement(1013300..1014187)
Genome map
AA seq 295 aa AA seqDB search
MTQRTITLIAGPTVSGKSALALQMAQKKNALIINTDSMQVYDVLNILTARPTEADTAIVP
HYLYGYVSPALHYSVGQWLCDVRKLLTTFTSKSLIFVGGTGLYFRALLEGLSEIPHISDT
VRQKWRLRLDKEGAENLYRQLLRIDAVFAEKISSQDGQRIIRALEVYDVTGKKLSWWQKK
KTPPLISPNCSEKILLIPPRQWLYERIHKRLDNMIERGALEEVFAMKKLMLSPFLPAMKA
IGMPEFTAYFDGYKSFEDALETAKTQTRRYAKRQMTWFRNQFDEEWTLISSCEEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacacagagaacgattacgttgatagctgggccaactgtaagtgggaagtcagcgctt
gctttgcaaatggctcaaaaaaaaaatgctcttatcattaacactgattcaatgcaggtt
tatgatgttttaaatattttaacggcacggccgacggaagctgatactgccattgttcca
cactatctctacggttatgtgagtccggctcttcactattcagtgggacagtggttatgt
gatgttaggaagcttttaacgacattcacctcaaaatcacttatttttgttggcggaaca
gggctttattttcgtgctcttttggaagggctttcggaaatccctcatatttcagatact
gtgcggcagaaatggcgacttcggcttgataaagaaggagctgaaaacctttatcgccag
ttattgcggattgatgctgtttttgctgagaaaatttcttcacaagatggccagcgtatt
atacgtgctctggaagtttatgatgtcacaggtaagaagttaagctggtggcagaagaaa
aaaacacctccgctgatttcgccaaattgttcagaaaaaattcttcttattccaccacgt
caatggctttatgagcgtattcataagcggttggacaatatgattgaaagaggagcttta
gaagaggtgtttgctatgaagaagcttatgctttccccttttttaccagcgatgaaggct
attggcatgcctgaatttacagcttattttgatggatataaaagttttgaggatgctctt
gaaacggcgaaaacgcaaacgaggagatatgcaaaaaggcaaatgacctggtttcgtaat
caatttgatgaagaatggacgctcatttcttcatgtgaagaggtgtag

DBGET integrated database retrieval system