KEGG   Bartonella quintana RM-11: RM11_0833Help
Entry
RM11_0833         CDS       T02294                                 

Definition
(GenBank) competence lipoprotein comL precursor
  KO
K05807  outer membrane protein assembly factor BamD
Organism
bqr  Bartonella quintana RM-11
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bqr02000]
    RM11_0833
Transporters [BR:bqr02000]
 Other Transporters
  Pores ion channels [TC:1]
   RM11_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YfiO TPR_18 TPR_6 TPR_16 TPR_19
Motif
Other DBs
NCBI-GeneID: 13563706
NCBI-ProteinID: AFR26550
Position
complement(1037090..1037917)
Genome map
AA seq 275 aa AA seqDB search
MGVVLLGSTCVLGGCLFKEKNTLDPSAYVLKMDPPDVLYNQALANLDSGRLGEASKKFLT
IEKQYAYTEWGRKSLVMGAFTNYQLAKYDEAISMAQRYITLYPGSDDSAYAYYIIGLSSF
CRIPDVTRDQRDTKRAIAAMQLLVERYPDSEYVKDAKAKIRIGREQLAGKEMQVGRYYEE
GQRYLAASRRFRKVVEEYSDTNQIEEALFRLTEVNLALGLTAEAQTAAAILGRNYPKSEW
YKFSYNLLKRNSISPQEHKSSWISRALNGDKNKVR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgtggtgcttttggggagcacctgtgtgttagggggatgcttatttaaagaaaaa
aatacccttgatccatctgcatatgttttaaaaatggatccaccagatgttctctataat
caggcacttgctaatcttgatagtgggcgacttggggaggcatcgaaaaagtttcttacg
attgaaaagcaatatgcttacactgaatggggacgtaaatctttagtgatgggtgctttt
acaaattaccaactcgccaaatatgatgaagcaattagcatggctcagcgctacattact
ctttatccagggtcagatgattcggcttatgcttattacattattggtctttcttctttc
tgtcggattcctgatgttacacgtgatcaacgcgataccaaacgtgctattgctgctatg
cagcttcttgtggagcgctatccggattctgagtatgtcaaggatgctaaagctaaaata
cgtattgggcgggagcagttagctggtaaagagatgcaggttggccgttattatgaggaa
ggtcagcgctatcttgctgcaagtagaagatttcgtaaagtggttgaagagtactccgat
acaaatcaaattgaagaagcgcttttccgcttgacggaggttaatcttgctcttggctta
accgcggaagcgcagaccgcagcagctattttaggacgtaattatcccaaaagtgagtgg
tataaattttcttacaatttgctaaagagaaatagtatatctccacaggagcataaatct
tcgtggatatcacgtgctttgaatggtgataagaataaggtacgttaa

DBGET integrated database retrieval system