KEGG   Bartonella quintana RM-11: RM11_0835Help
Entry
RM11_0835         CDS       T02294                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
bqr  Bartonella quintana RM-11
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bqr03036]
    RM11_0835
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bqr04812]
    RM11_0835
   02048 Prokaryotic Defense System [BR:bqr02048]
    RM11_0835
Chromosome and associated proteins [BR:bqr03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    RM11_0835
Cytoskeleton proteins [BR:bqr04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   RM11_0835
Prokaryotic defense system [BR:bqr02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    RM11_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C Hox9_act Tubulin_2
Motif
Other DBs
NCBI-GeneID: 13563708
NCBI-ProteinID: AFR26552
Position
complement(1039243..1041036)
Genome map
AA seq 597 aa AA seqDB search
MSYEKEKKMTINLHRPDIAELKPRITVFGVGGGGGNAVNNMINAGLQGVDFVVANTDAQA
LAMSKAERVIQLGAAVTEGLGAGALPEVGQAAADECIDEIIDHLADSHMVFITAGMGGGT
GTGAAPVVARAAREKGILTVGVVTKPFQFEGARRMKTAEAGIEELQKSVDTLIVIPNQNL
FRIADEKTTFADAFAMADQVLYSGVASITDLMIKEGLINLDFADVRSVMHEMGRAMMGTG
EASGEGRSLAAAEAAIANPLLDDTSMRGARGLLISITGGRDMTLFEVDEAANRIREEVDA
DANVIFGAIDDESLEGVIRVSVVATGIDREVNDVVQPSHPQLQRQATSVRKNDPGMPQTS
FHLQSPPLRSESMVEVIEALEIEKGKSIGEQFRPKSQIFSQPVDTVAARNANSVSYGSNV
VHGQISNATRPQFSRCSQQSMAASVSMEATAHILDEMIGVKQKENQVQQKEMQQMRARSA
PMRMPELKDFPPVAHGQSERSSTADQGPRNLWQRLKQSLTHREEAEPQAHLEPAVRSSQQ
QNVHVYNKNSQAFPQDASVYVPRRSGELHPHVAQDQRTFISEEDQLEIPAFLRRQVN
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatgagaaggaaaagaaaatgacgattaatctgcatcggccagatatcgcggaa
ttgaagccacgcattaccgttttcggggttggcggtggtggcgggaatgccgtgaataat
atgattaatgctggtcttcaaggagttgactttgttgttgctaatacggatgcacaggct
ttggctatgtcaaaggctgaacgcgttatccagcttggcgcagcagtgacagaaggtcta
ggtgctggggctttgccagaagttggacaagcggctgctgatgaatgtattgatgaaatt
atcgaccatcttgcagattcccatatggttttcattactgctgggatgggcgggggtacc
ggaacaggggcagctcctgttgttgcacgcgccgctcgtgaaaaaggtattttgactgtt
ggtgttgtgacaaagccatttcaatttgaaggtgctcgccgtatgaaaacagcagaggct
ggtattgaagaattacaaaaatctgttgatacattgattgttatacccaatcagaatctt
ttccgtattgcagatgaaaaaacaacatttgctgatgcttttgctatggctgaccaagtg
ctttactctggtgttgcttccattacggacttaatgattaaagaggggctcattaacctt
gattttgctgatgtccgttctgttatgcacgaaatgggccgtgcgatgatgggaactggt
gaggcatctggtgaagggcgttctttggctgctgctgaagctgctattgccaatccgttg
ttggatgatacttctatgcgtggtgctcgtggtcttttgatttccattactggtggtcgt
gatatgactttgtttgaagtcgatgaagcagctaatcgtattcgcgaagaagttgatgct
gatgccaatgttatctttggtgctattgatgatgaatcacttgaaggtgttattcgtgtt
tctgtggttgcaacaggaatcgatcgtgaggttaatgatgtggttcagccttctcatcct
caacttcaaagacaggcgacttcagttcgtaaaaatgatcctggaatgcctcaaacttct
tttcatcttcaatcaccacccttgcgttctgagtcaatggtagaagtaatagaagcactt
gaaatagaaaagggcaaatcaattggagaacagttccgccctaaaagtcaaattttttca
cagcctgtggatacagttgctgcacgaaatgcaaattctgtgtcttatggatcaaatgtc
gtccatgggcagatttcaaatgcgacacgtccgcagtttagccgttgttctcagcagtct
atggccgcatcagtaagtatggaggcgacagcacatattcttgatgagatgataggggtt
aagcagaaagaaaatcaagtacagcaaaaggaaatgcaacagatgcgggctcgttcagca
ccgatgcgtatgcctgagttaaaggattttccccctgttgcccatggtcaaagtgagagg
tcatctactgctgaccaaggacctcgcaatctttggcagcgtttaaaacagagcttgacc
catcgtgaggaagctgagccacaagctcacttggagcctgctgtgagatcttctcagcag
caaaacgtgcatgtttataataaaaattctcaggcatttccccaagatgcttctgtttat
gttccacgtcgttctggtgagttgcatccccatgtagcacaagatcaacgtacttttata
agtgaagaagatcagttggaaataccagcatttttgcgtcgtcaggtaaattaa

DBGET integrated database retrieval system