KEGG   Bartonella quintana RM-11: RM11_0839Help
Entry
RM11_0839         CDS       T02294                                 

Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
bqr  Bartonella quintana RM-11
Pathway
bqr00520  Amino sugar and nucleotide sugar metabolism
bqr00550  Peptidoglycan biosynthesis
bqr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RM11_0839
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RM11_0839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bqr01011]
    RM11_0839
Enzymes [BR:bqr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     RM11_0839
Peptidoglycan biosynthesis and degradation proteins [BR:bqr01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   RM11_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurB_C FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 13563712
NCBI-ProteinID: AFR26556
Position
complement(1044449..1045402)
Genome map
AA seq 317 aa AA seqDB search
MIDGEALLAQLQPALGDIKGKLTPNVDMRKVTWFRTGGLAELFYQPADEADLALFLKTLP
EFISVTIVGIGSNLLVRDGGIPGVVIRLSAKGFGQVQQVSPKRFLVGAATAGKHLAAAAL
EAEITGFHFYHGIPGGLGGALKMNAGANGIETAARVVEVYALDRKGRHHILSLADMHYSY
RHCAIPKDFIFTAALLEGEPGNRDDIRAAMDEVALHRETVQPVREKTGGSTFRNPENISA
WRVIDEAGCRGLQIGGAQMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWE
IQRIGQFEQSRIVPSFG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatggtgaagcgctgttggcgcaattgcaaccggcgttaggcgatataaagggc
aagcttacgcctaatgttgatatgcggaaggtaacgtggtttcgcactggtggtttggct
gagcttttttatcagcctgctgatgaggcagatttagctctctttcttaaaactttgcct
gaatttatttctgtaacaattgtgggaattggttctaatcttctggtacgtgatggtggg
attcctggagttgttattcgtctttcagcaaaaggttttgggcaagtgcagcaggtttct
ccaaagcgctttctggttggtgctgctacggcgggtaaacatttagcagcggcagctttg
gaggccgagattacaggttttcatttttatcatggtattcctggtggtcttggaggagca
ttaaaaatgaatgcaggggctaatggtattgaaacagctgcgcgtgttgttgaggtctac
gcccttgatcgtaaagggcggcatcatatcttgagtttggcagatatgcattattcttat
cgtcattgtgctatccctaaagatttcatttttactgctgctttgttagaaggcgagcca
ggaaatagagacgatattcgtgcggctatggatgaagttgctcttcatcgggaaacagta
caacctgttcgtgaaaagaccggtgggtcaacattccgaaatcctgaaaatatctctgcg
tggcgcgttattgatgaggcaggatgccgtggtttgcagattggtggagctcaaatgagt
gaaatgcactgtaattttatgattaatacagggcaagcaacaggttatgatcttgaagca
ttgggagaaacagtgcgtgctcgtgtttttgctcattcggctcacctattacagtgggaa
atacagcgtatcggtcaatttgaacaaagccgtattgttccttcttttggctag

DBGET integrated database retrieval system