KEGG   Bartonella quintana Toulouse: BQ04570
Entry
BQ04570           CDS       T00181                                 
Symbol
gmk
Name
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu00230  Purine metabolism
bqu01100  Metabolic pathways
bqu01232  Nucleotide metabolism
Module
bqu_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BQ04570 (gmk)
Enzymes [BR:bqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BQ04570 (gmk)
SSDB
Motif
Pfam: Guanylate_kin AAA_33 Zeta_toxin AAA_16 TsaE RsgA_GTPase MMR_HSR1 RNA_helicase ABC_tran
Other DBs
NCBI-ProteinID: CAF25956
UniProt: Q6G053
Position
559524..560189
AA seq 221 aa
MTFFESELSAKKRDQRRGFLFILSSPSGAGKSTLSRLLLKDAQLERSVSVTTRQRRPSEV
DGFHYHFVSKQEFECKRDGDEFIEWAEVHGNYYGTLRKSVENALSAGRDILFDIDYQGTE
QLQKKMPGDTVSIFILPPSMKELILRLHRRAEDSQDIINLRLKNAQTEMQHWRFYDYVVI
NKDLNQSASLIKSIYLAETARRKRCSFLESFVDGLIDEKIN
NT seq 666 nt   +upstreamnt  +downstreamnt
atgacattctttgaaagtgaattgagtgctaaaaaaagagatcagcgtcgtggtttttta
tttattctctcttcaccttcaggagctggtaaatcaaccctttcacggttacttctgaag
gatgcacaattagagcgctccgtgagtgtgacgacacggcaaagacgtcctagtgaggtg
gatggttttcattatcattttgtttcaaagcaagagtttgaatgcaagcgtgatggtgat
gaatttattgaatgggcagaagttcatggaaattattacggaactttacgtaaaagcgtt
gaaaacgctttaagtgctggtcgagatattttatttgatattgattatcaaggcaccgag
cagcttcaaaaaaagatgccaggggataccgtatctatttttattcttccaccatcaatg
aaagaactcattttgcgtttacatcgtcgggcggaagatagccaggatatcatcaattta
cgattgaagaatgcacaaacggaaatgcagcattggcgtttttatgattatgttgtcatt
aataaggatttaaatcagtctgcatcacttattaaatcaatttatttagctgaaacagcg
agacgcaagcgatgttcctttcttgaatcttttgttgatgggctgattgatgaaaagatt
aattga

DBGET integrated database retrieval system