KEGG   Bartonella quintana Toulouse: BQ00460Help
Entry
BQ00460           CDS       T00181                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu00300  Lysine biosynthesis
bqu01100  Metabolic pathways
bqu01120  Microbial metabolism in diverse environments
bqu01230  Biosynthesis of amino acids
Module
bqu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BQ00460 (dapE)
Enzymes [BR:bqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BQ00460 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAF25553
UniProt: Q6G1H9
Position
66765..67937
Genome map
AA seq 390 aa AA seqDB search
MPVLTDPLQLLQALIRCPSVTPYEAGALSTLEQILTKMGFNVKRPVFTDKNTEDVENLYA
KMGGEGRHLMFAGHTDVVPPGALEDWTYPPFEGVIDQGKLYGRGAVDMKGGIACFVAALA
RILEKRSIKGMVSLLITGDEEGPALNGTVKLLKWAEQKGEKWTAALVGEPTSVKTVGDVI
KIGRRGSLSGVVTVKGRQGHVAFPERAANPLPLAGKLIQALTQTALDRGTENFQPSNLEL
TTIDTDNPAVNVIPAQTTIRFNIRYNDVWTKETLMTEIEKRLASVQLKNNDYQYPYYQLE
WIPSLGSVFITKNDKLIKTLSNAIESVTGNIPEYSTSGGTSDARFIKDYCPVVEFGLPGQ
TMHMVDECVTLDAIETLTSVYERFIVDFFA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttcttacagatccacttcagctattacaagcgcttattcgttgcccttctgtg
accccttatgaagcaggtgccttgtcaactttggaacagattttaacaaagatgggattt
aatgttaagcgtcctgtttttactgataaaaatacagaagatgttgaaaatctttatgcc
aagatgggcggagaaggacgacatcttatgtttgcaggtcatactgatgttgtgccgcca
ggcgcgttagaagattggacataccctccttttgaaggtgtcatagatcagggaaaatta
tacgggcgaggtgctgttgatatgaagggcggaatcgcgtgttttgttgcggcgctggct
cggatccttgaaaaacggtcgattaaaggaatggtaagccttttgatcaccggagacgaa
gagggtcctgcacttaacggtacagtcaaacttctgaaatgggccgagcaaaaaggtgaa
aaatggacagcagctcttgtgggagaaccaacaagcgtaaaaactgttggtgatgtcatt
aagattgggcgccggggatcactttctggtgtcgtgacggttaaaggtcgacaaggtcat
gttgcttttcccgagcgggcagccaatccattgcctttagcaggtaaacttattcaagca
ttgacacaaactgctttagatcgaggaacagagaattttcaaccaagcaatttggaatta
acaactattgatacggataaccctgcggtaaatgttattccagcgcagacaacgatccgc
tttaatatacgctacaatgatgtttggacaaaagaaacgcttatgacggaaattgaaaaa
cgtcttgcttcggtgcaattaaaaaacaatgattatcaatacccctactatcagcttgaa
tggattccaagcttggggagtgtttttataactaaaaatgacaaactcattaaaacttta
tcaaatgctattgaaagcgtcacagggaatataccagaatactcaacttcagggggcaca
tcggatgcgcgatttattaaagattattgcccagtggttgaatttggtttaccgggacaa
acgatgcatatggtagatgagtgtgtgactcttgacgcaatagaaaccctcacctctgtt
tatgaacgtttcattgttgatttttttgcgtaa

DBGET integrated database retrieval system