KEGG   Bartonella quintana Toulouse: BQ02700Help
Entry
BQ02700           CDS       T00181                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K16784  biotin transport system ATP-binding protein [EC:3.6.3.-]
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BQ02700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bqu02000]
    BQ02700
Enzymes [BR:bqu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BQ02700
Transporters [BR:bqu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter
    BQ02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_29 DUF87 FtsK_SpoIIIE AAA_24 AAA_33 AAA_13 AAA_23 AAA_18 RsgA_GTPase G-alpha NTPase_1 AAA_22 DEAD
Motif
Other DBs
NCBI-ProteinID: CAF25772
UniProt: Q6G1D9
Position
339673..340353
Genome map
AA seq 226 aa AA seqDB search
MGIIKFDKVTQVFGDLCVLRDITVQLTEKRIAVIGANGSGKSTFVRLINGLQLPSNGFVS
VDGLDTKRDAKAVKRKVGFVFQNPDNQIVLPLVEEDLSFGLKNLNLSKDEIKKRVDEILQ
RYDLQAFKNHAVHLLSGGQKQLVAISSVVAMKPDYIVFDEPTTLLDLRNKRRVTQVIEEL
PQTAIVVSHDLEFLKNFDRILVFDKGEIAIDDVPLVAIKEYIRRMS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgggaatcataaaatttgataaggtcacacaggtctttggtgatttgtgcgttttaagg
gatattactgtacagcttactgagaaacgaattgcagtgattggtgcgaatggttctgga
aaaagtacattcgtccgtcttattaatgggttacaacttccatcaaatggttttgtgagt
gttgatgggcttgatacaaaacgcgatgcaaaggcggtgaagcgtaaagtaggatttgtt
ttccaaaatcccgacaatcagattgtattaccgttagtggaagaagatttatcttttggt
ctaaaaaatttgaaccttagtaaggatgaaatcaagaaacgtgtggatgaaattttacag
cgttatgatctccaggcctttaaaaatcacgcggttcatttattgagtggtggacaaaaa
caactcgttgccatttctagtgtagtagcaatgaaaccagactatattgtttttgatgag
cctacgacattacttgatttacgaaataaacgccgtgttacacaagttatagaggaatta
ccacaaacagcgatcgttgtatcacatgatttggaatttttgaaaaattttgatagaata
ctcgtttttgataagggggagatagctattgatgatgtgcctttggttgctatcaaggaa
tatataagaaggatgtcatga

DBGET integrated database retrieval system